SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301608776|gb|XP_002933949| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301608776|gb|XP_002933949|
Domain Number 1 Region: 36-250
Classification Level Classification E-value
Superfamily L domain-like 1.14e-34
Family Ngr ectodomain-like 0.0047
Further Details:      
 
Domain Number 2 Region: 246-344
Classification Level Classification E-value
Superfamily Immunoglobulin 2.76e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 373-441
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000526
Family Fibronectin type III 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301608776|gb|XP_002933949|
Sequence length 570
Comment PREDICTED: leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2-like [Xenopus (Silurana) tropicalis]
Sequence
MEVFCSIFLFLLFVRLCLGSLPCVTGCSCANDTFGRSLLCMSSSLKKIPSDIPPDIRKIR
IENCHLTELSRGSFGSVHTLHYLWLNFNNITVMQMKSLEDVKSLTELRLQGNKLRSIPWT
AFQDTPNLKILDLKHNRLDVLPEHALKFLANLTYLDLSFNQLTVISKDVFANWPLYQKAH
RSDRREDVLSNAVLALHENPWTCDCRLKGFVQFVKAVSPPIILMNSYLTCISPNSKAGKF
FHEIDLKSCLKPLVSTPLSNLTIQVGLNATLSCFVKASPMPSIWWTYGLKVVKAFNVSTT
TINEETIKSELIIPAVHVTDAGIYKCIATNFLGNSSASILLNVQSNKLGNASPSLSYSLP
PSSSSSQEHVFIDLRISKQTAYGISLEWFAVTENPGETWYTIYFGKYEDTQKEVINIGPG
IYSYSVNDLLPITKYEVCVTLKSQLPKKGQCIVFMTGSDISELEQREKLIHIIVIVCAMV
LAVPAGMYACTTETRFNCLDKCLGLCRRKHKAQKTLKKDNTKESTFDSLQASSEEGLCQR
EGNEENRRRRCSEEKLNKPKPENRNTADLY
Download sequence
Identical sequences F6ZG23
XP_002933949.1.99540 gi|301608776|gb|XP_002933949| ENSXETP00000012419 ENSXETP00000012419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]