SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301609207|gb|XP_002934163| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301609207|gb|XP_002934163|
Domain Number 1 Region: 304-594
Classification Level Classification E-value
Superfamily Kelch motif 4.45e-76
Family Kelch motif 0.000086
Further Details:      
 
Domain Number 2 Region: 8-62,107-163
Classification Level Classification E-value
Superfamily POZ domain 9.42e-27
Family BTB/POZ domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301609207|gb|XP_002934163|
Sequence length 610
Comment PREDICTED: kelch-like protein 14-like [Xenopus (Silurana) tropicalis]
Sequence
MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRS
LFSSHPGQDVLPNVPKDQQQQQSEEPGTPSSSPDDKLLVSPRAINNLVLQGCSSIGLRLV
LEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLSVQFLNDQISVQNYKQVCKIAALHSL
EETKKLANKYLVEDVLLLNFEEMRAMLDSLPPPVESELALFQMTVLWLEHDRETRMQYAP
DLMKRLRFALIPAPELVERVQSVDFMRSDPVCQKLLLDAMNYHLMPFRQHCRQSVASRIR
SNKKMLLLVGGLPPGPDRLPSNLVQYYDDEKKTWKILTIMPYNSAHHCVVEVENFLFVLG
GEDQWNPNGKHSTNFVSRYDPRFNSWIQLPPMQERRASFYACRLEKHLYVIGGRNETGYL
SSVECYNLETNEWRYVSSLPQPLAAHAGAVHNGKIYISGGVHNGEYVQWLYCYDPVMDVW
ARKQDMNTKRAIHALAVMNDRLYAIGGNHLKGFSHLDVMLVECYDPKGDQWNILQTPILE
GRSGPGCAVLDDRCYLVGGYSWSMGAYKSSTICYSPEKASWTELEGDVAEPLAGPACATV
ILPACVPYNK
Download sequence
Identical sequences XP_002934163.1.99540 8364.ENSXETP00000044375 gi|301609207|gb|XP_002934163|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]