SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301609688|gb|XP_002934389| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|301609688|gb|XP_002934389|
Domain Number - Region: 53-148
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00314
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301609688|gb|XP_002934389|
Sequence length 842
Comment PREDICTED: vacuolar protein sorting-associated protein 53 homolog [Xenopus (Silurana) tropicalis]
Sequence
mdeeelevveeleavlhlspevqqaieqvfpsqdpldradfnaveyintlfpteqslsni
ddvvskirlkirrlddnirtvvrgqtnvgqdgrqaleeaqkaiqqlfgkikdikdkaeks
eqmvkeitrdikqldhakrhlttsittlnhlhmlaggvdsleamtrkrqygevanllqgv
vnvlehfqkymgipqirqlservkaaqtelgqqiladfeesfpsqgtkrpggpsnvlrda
clvanvldsrikqeiikkfirqhlseysvlfqenqdvawldkidrryawikrqlvdyeek
ygrmfpvdwcmteriavefchitrndlskimrtrakeievklllfaiqrttnfegllakr
fsgstlsdnvvkkpdpqppvstnpfldddnltdesvldkdsdldkpkkpklpenpfhgii
skcfephlyvyiesqdknlselidrfvgdfkaqgppkstsedagavlpscadlfvyykkc
mvqcsqlstgepmialstifqkylreyawkilsgnlpktsssssgltitsllkekegsev
akftpeelclicsilstaeyclattqqvkifyivtfptqerlsssqiqrintngecikyw
lhvysfsvisnsiqllvqdldsscdpaliamskmqwqnvehvgdqspyvtsiifhikqsv
piirdnlastrkyftqfcikfansfipkfinhlfkckpismvgaeqllldthslktvlld
lpsigsqvirkapasytkivvkgmtraemilkvvmaphepsvvfvdnyiklladcttetf
qkilemkglkrseqstmldlfrqrlpappsgsenssaalpaptpeqessrirkleklikk
rl
Download sequence
Identical sequences gi|301609688|gb|XP_002934389|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]