SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301609741|gb|XP_002934416| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301609741|gb|XP_002934416|
Domain Number 1 Region: 1119-1420
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.14e-88
Family Complement components 0.00000965
Further Details:      
 
Domain Number 2 Region: 1534-1664
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.84e-33
Family Alpha-macroglobulin receptor domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1694-1744
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000554
Family Ovomucoid domain III-like 0.017
Further Details:      
 
Domain Number 4 Region: 786-877
Classification Level Classification E-value
Superfamily E set domains 0.00000392
Family SVA-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301609741|gb|XP_002934416|
Sequence length 1827
Comment PREDICTED: c3 and PZP-like alpha-2-macroglobulin domain-containing protein 8-like [Xenopus (Silurana) tropicalis]
Sequence
mlflwivwiicsfsraedrqgylvaapsvfrsgveevvsvtifnattetkvqlqlvvkge
tvahghgivldkgtvkilvpsglrgqanlkvwgnrhlteegfsfhnsttvtvdskgssvf
iqtdkpiykpkqkvlinmfmvtpdlrptsekieayildprgsriiqwtdlrpiccgvvnm
sfplsdqpvfgewlifaetqghtynksfsvqkyvlpkfelvisppsyirdigtcekgtvk
arytfgkpvkglltinmtvtgvgyykheiglqvlktmeiygsavfdicakdmmpvdfpeh
frgtvniwatvisvdgskqvtfddstpvqkqlidikytkdtkkqfkpglpyqgkvevtyp
dgspadgvtvqikaeltpkdnvytselvsrnglvefqipsiptgaqyvwletkvmaidgk
pageqylpnylsisswyspskchlliqppeepllvgeearialkstcpcnstlhyelvar
gnivlsgkqpgkvtlkrskrdafvtfdkdthesvtntastqipsedstvwltyvhftvth
nmaplsrilvyyvrengegvtdsaqipikpvfenqvsltlstnnsrpgdavdinvkaakg
scvcvatvdksvyllrngfqltpeqifqelsefdvsdgtgkdeghfwwpgmgsqrrrrss
lfpwhwditkdarfaftetglivmtdivslnhrqsggmytdeavpafqphtgtlvgssyt
rmatrtekrkrtffpetwvwhcfnvsdvtgeqqlhvevpdsittwiteaiaisskkglgv
agqahlkafkpffidftlpyhvirgeqvkipltvynylpvgvevhvkitipkgikfvgyp
gkqylirklcvasgetkptsavfaftdlgqanisaralafagmscfpegntlrnkhadda
ylekkvpagtdfvrrslmvepeglareytysvffcpnekiqistpnkfeyqyvqkpqrmt
hfdltvkahndahialssgphdmaemieiviggqqnsrtwistskmgdpvssastssvls
wdefrafwiswkngviqvgygiyssndsvivewtvdrqpdvkfigfstgwgsmgefkiwr
keetdenhneaftlgvphnvipgseratasiigdvmgptvsnldnllrlpfgcgeqnmih
fapnvfvlkylqktrqlcpeveseavdylvqgyqrqltykrldgsysafgerdssgsmwl
tafvlksfaqsrgfifidpgelsaakdwiiqhqnkdgsfpamgrilnkdiqggnhgkial
tayvaaalletgvtsederiavskaklfleshlftvddpyttaltsyaltllrstyapva
lrklnamaithdgfthwsltgsaateedtfmgfndglsqsvisaevemtayalltytlmg
dvasalpvvkwlsqqrnslggfsstqdtcvalqalaeyailsyvggvnltislastnldy
qetfelhrlnkkilqtakipsiptglfvsakgegcclmqidvhynvpdpvakpafqlliy
lkepklsrkrrhvvhqetplrdralpddddpgshqdhqeykitleactrwlhagasnmav
lelallsgfradiesleqlllnkqiglkryeidgrkvlfyfdeipsqcltcvklqafrey
ivgktapvpvkiydyyeptfeatrfynasessplsrelcdgttcnevessanhwtafspn
gpcsgtfscpeedhfercmcyrdcgydgdpvcgsdgtvyqnqcqlevtacrnntriervp
msqctpeetvsedathvtinkdqdmipekteeevtshntevsyysyeydvdpyaaesedn
femgvelitvsssveesgkiytaatee
Download sequence
Identical sequences gi|301609741|gb|XP_002934416| XP_002934416.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]