SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301610693|gb|XP_002934870| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301610693|gb|XP_002934870|
Domain Number 1 Region: 307-574
Classification Level Classification E-value
Superfamily Kelch motif 6.02e-65
Family Kelch motif 0.0000586
Further Details:      
 
Domain Number 2 Region: 22-142
Classification Level Classification E-value
Superfamily POZ domain 5.76e-33
Family BTB/POZ domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301610693|gb|XP_002934870|
Sequence length 589
Comment PREDICTED: ectoderm-neural cortex protein 1 [Xenopus (Silurana) tropicalis]
Sequence
MSVSLHENRKSRASTGSMNIYLFHKSSYADSVLTHLNLLRKQCLFTDVLLLAGNRSFPCH
RAVLAACSRYFEAMFSGGLKESQANEVNFHSAVHPEVLELLLDYAYSSRVIINEENAESL
LEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLNNFQTIC
KTEDFLLLPKDLVVQLLSNEELETEDERMVYESAMNWIHYDLNKRHCYLSELLQTVRLAL
LPAIYLMENVAMEELIIKQKKSKELVEEAIRCKLKILQNDGVVTSLCAKPRKTGHALFLL
GGQTFMCDKLYLVDQKAKEIIPKADIPSPRKEFSACAIGCKVYITGGRGSENGVSKDVWV
YDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEQYDPV
TNKWTMVAPLREGVSNAAVVSAKLKLFAFGGTSVSHDKLPKVQCYDPSENRWSVPATCPQ
PWRYTAAAVLGTQIFIMGGDTEFSACSAYKFNSETYQWTKAGDVTAKRMSCHAVASGNKL
FVVGGYFGIQRCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS
Download sequence
Identical sequences F6X0G5
XP_002934870.1.99540 ENSXETP00000011068 gi|301610693|gb|XP_002934870| ENSXETP00000011068 8364.ENSXETP00000011068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]