SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301610740|gb|XP_002934899| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301610740|gb|XP_002934899|
Domain Number 1 Region: 318-611
Classification Level Classification E-value
Superfamily Kelch motif 1.1e-69
Family Kelch motif 0.0000299
Further Details:      
 
Domain Number 2 Region: 51-165
Classification Level Classification E-value
Superfamily POZ domain 1.1e-25
Family BTB/POZ domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301610740|gb|XP_002934899|
Sequence length 634
Comment PREDICTED: kelch-like protein 31-like [Xenopus (Silurana) tropicalis]
Sequence
mapkkknakknkadinemtiivedsplsklnglsglidggngfsyistevtdssygttlm
egmsrmrqdsflcdltigtktksfmvhkvvmascseyfydilkkdsstqrvdlndisplg
latvityaytgkitlslytigstissaiylqinalvnmccdflmqemnvencmyvaniae
tyglkstkeaaqkfirdnfiefsdtdqflkltfdqinelliddylqlpseivafqiamkw
ldfdekrikyasellsnirfgtisaqdlvnyvqsvprmmqdtdchrllveamnyhllpyh
qntlqsrrtkirggsrvlvtvggrpalaekslsreilyrdpdggwkrlaelpaksfnqcv
tvmdgflyiaggedqndarnqakhavsnfcrydprfntwihlanmiqkrthfsfnvfngl
ifaiggrnsdgglasvecyvpstnqwqmkaplevarcchsssiidgkilvvggyinnays
rsvcmydpsmdswqdkanlstprgwhcsvtlgdrvyvmggsqlggrgervdvlpvecynp
htgqwsyvaplqngvstagastlngkiylvggwnevekkykkciqcynpdlnewteedel
peatvgvsccsinmpnfktresrassvssvpvsi
Download sequence
Identical sequences XP_002934899.1.99540 XP_004914550.1.99540 XP_004914551.1.99540 gi|301610740|gb|XP_002934899|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]