SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301610756|gb|XP_002934895| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301610756|gb|XP_002934895|
Domain Number 1 Region: 260-363
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-32
Family Spermadhesin, CUB domain 0.00093
Further Details:      
 
Domain Number 2 Region: 84-192
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-32
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 3 Region: 401-473
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.14e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 197-262
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000119
Family Complement control module/SCR domain 0.00088
Further Details:      
 
Domain Number 5 Region: 464-495
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000628
Family Spermadhesin, CUB domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301610756|gb|XP_002934895|
Sequence length 501
Comment PREDICTED: CUB and sushi domain-containing protein 1-like, partial [Xenopus (Silurana) tropicalis]
Sequence
mrakrahrqlqvasdlpfqpgsllhfwlapspgalisgtfirdghlpfpshwmcgintvm
nafwklkyllllclgffnaakgqscgglvqgpngtiespgfphgypnyanctwiiitger
nriqlsfqifaleedfdilsvydgqpqqgnlkvrlsgfqlpssivstgsivtlwfttdfa
vsaqgfkavyevlpshtcgnpgeiskgllhgtrfnigdkiryscitgyileghstltciv
spgngaswdfpspfcraegscggtlrgtsgiissphfpseyennadctwtilaepgdtia
lvftdfqmeegydfleisgtdapsiwltgmnlpspvisnknwlrlhftsdsnhrrkgfna
qfqvkkaielksrgvkmlpskesnhknsvlsqggvpmatdmcpdpgvpengkragfdfrv
ganvqfscddnyvlqgsksitcqrvtdtlaawsdhrpicrartcgsnlqgpsgiitspny
pvqyednahcvwvitsvnpek
Download sequence
Identical sequences gi|301610756|gb|XP_002934895|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]