SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301610774|gb|XP_002934922| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301610774|gb|XP_002934922|
Domain Number 1 Region: 142-246
Classification Level Classification E-value
Superfamily Immunoglobulin 1.88e-21
Family C1 set domains (antibody constant domain-like) 0.066
Further Details:      
 
Domain Number 2 Region: 330-418
Classification Level Classification E-value
Superfamily Immunoglobulin 2.75e-18
Family I set domains 0.027
Further Details:      
 
Domain Number 3 Region: 46-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000133
Family I set domains 0.049
Further Details:      
 
Domain Number 4 Region: 414-510
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000348
Family I set domains 0.036
Further Details:      
 
Domain Number 5 Region: 242-327
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000818
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301610774|gb|XP_002934922|
Sequence length 513
Comment PREDICTED: kin of IRRE-like protein 3-like, partial [Xenopus (Silurana) tropicalis]
Sequence
mllgtkpsrldlllltcillsresgltlgfmskdkfrkmsegqssftqqpqdqvvvagqp
vsllcaipgyhglllwikdglaigvgrdlsgyprysvggdhlsgehhlmiqraelqddam
yecqaiqaairsrparltvlvppddpvitggpvisiragdplnltchadnakpaatitwm
kngevlngatyyktllrdgkresiistlfvsssdiengqtitcratnkavpggkeatvti
niqhpplvnltvepqpvlednvvkfhcaakanpavtqyrwakggqilkevtdetyetvvd
fsfftepvscevtnalgstnvsrtvdvyfgprmssepesitvdlgsdatfhcawignpsl
tivwmkrgsgvvlsnentltlknvrqedagkyvcravvprvgagerdisltvngppiiss
tqtqhalhgekgqikcfirstpppdriawswkenvlesgtsgrytvetvstdegvistlt
isnivradfqtiynctawnsfgsdteiirlkeq
Download sequence
Identical sequences gi|301610774|gb|XP_002934922|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]