SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301610940|gb|XP_002935001| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301610940|gb|XP_002935001|
Domain Number 1 Region: 37-509
Classification Level Classification E-value
Superfamily Sema domain 3.4e-141
Family Sema domain 0.0000000000384
Further Details:      
 
Domain Number 2 Region: 1073-1335
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.52e-79
Family Protein kinases, catalytic subunit 0.000000000311
Further Details:      
 
Domain Number 3 Region: 647-735
Classification Level Classification E-value
Superfamily E set domains 6.24e-16
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Domain Number 4 Region: 553-650
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000356
Family Other IPT/TIG domains 0.063
Further Details:      
 
Domain Number 5 Region: 511-556
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000811
Family Plexin repeat 0.0005
Further Details:      
 
Domain Number 6 Region: 733-821
Classification Level Classification E-value
Superfamily E set domains 0.0000000091
Family E-set domains of sugar-utilizing enzymes 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301610940|gb|XP_002935001|
Sequence length 1375
Comment PREDICTED: hepatocyte growth factor receptor-like [Xenopus (Silurana) tropicalis]
Sequence
MLVAVPVAFVFLSLLLKCMGQCEEAAKMAEMDLNIKHNLQSFTTDTPIQNIIMFKGYIYV
GAVNKIYVLNENLTKVSEYKTGPLLVHSHCLPCKNCTDNFLSPNGTWKDNVNMALFVEDF
YDDQLISCGNIRRGECQRHTLHSDKPWDIASNVHCLYSSQMIEDKDNCPDCIVSTTGSKI
LVTVRDRFVKFFVGSTLTGQPSTIHSVSVRRLKETQDGFEYLTDQSYIDVLPQLRDIYPI
KYIYTFESNNFVYFLTVQRESIDSQAYHTRIVRVCSSDSELRSYIEMPLECIFTEKRRKR
STAGAVFNILQAAYLGRAGEDLAEEMGVKPDDDILYAVFAQSKLDSSEANNRSAVCAVSV
KTINEFFNNAADKQNTKCLEHFYEKDNRLCINNKKFLRNASYCSTPIDEYRVEVTTVLRR
LDLFMDQFRNVLLTSISVFTQGRLTIANLGTSEGRFMQVVISRTGQPKPHVNFLLEPRPV
SPEVVINPASEESGYTLVNTGMQLTKVPLVVLTCGHLKSCSHCLSSPSVNCGWCKNRCTR
KQECLNEEWIQETCPPAVYEVFPSSAPLEGGTQLTICGSDFVLSKNNNFDLKNTMVIIGK
KRCKIEGKFSNQNKLVCRIDSSASSVFNISSSVSNGKQVVNFTTFSYVNPIITSIMPSHG
PKAGRTLITMKGQYLNSGKEQKVIIGKEMCKIKSVSSAAIECYTPVQRTTGTYLVALKID
NADRESSTRFTYMEDPSVSNIKPVKSFLSGGSSITAYGRNLNAVASPQMVIRLSKPELSY
NMSCIHRSTSELICCSTPSLKELNLEPPITTQVFFILDGVISNYFELSYVNNPIFETFEK
PVVFPIGNKNILEIKGDHIDSEAVRGEVLKVGNKSCEIIQSKSDSVSCSVPTDLFKSNSE
LKIEFLQGVSSIIIGKVMVTQDQNFTGIITGVVSCVVLLLIIFGVLIWMKKRKQLKDLGG
DMVLYDGRVHTPHLDRLVSARSISPTTEMVSSESVDYRSTVQEDPFPNSSQNGSCRPAQY
AHRDLSPILSSGDSDIASPLLHSYVHIDISALSTDLMKEVEHMVIRVDRLIVHFNKVIGR
GHFGCVYHGTLLDIDGKNVHCAVKSLNRITDIEEVSQFLKEGIIMKDFSHPNVLSLLGIC
LPNEGSPLVVLPFMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMEYLASKKFVHRDLA
ARNCMLDEHFTVKVADFGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDV
WSFGILLWELMTRGAPPYPDVNSFDITIYLLQGRRLLQPEYCPDPLFEVMLKCWHPRPEL
RPTFSELVSRISSIFSTFIGEHYVLFNATYVNIKCAAPYPSLLSPEDNTECSIDT
Download sequence
Identical sequences XP_002935001.1.99540 gi|301610940|gb|XP_002935001| 8364.ENSXETP00000047038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]