SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301611019|gb|XP_002935040| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301611019|gb|XP_002935040|
Domain Number 1 Region: 140-202
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.01e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 2 Region: 199-269
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.3e-16
Family Complement control module/SCR domain 0.00037
Further Details:      
 
Domain Number 3 Region: 77-143
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000472
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|301611019|gb|XP_002935040|
Domain Number - Region: 31-73
Classification Level Classification E-value
Superfamily Elafin-like 0.0188
Family Elafin-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301611019|gb|XP_002935040|
Sequence length 286
Comment PREDICTED: beta-2-glycoprotein 1-like [Xenopus (Silurana) tropicalis]
Sequence
mgsqkpknmdimvlvivilqalmvfseqdvwnscpvrkenpvgqacqkactqhgdcagkr
qclcdgdcgmscvlvrscpwpvaienaetklvtesrnfgdemlvmcqpgfkmatgqemal
srcqgdkkwsvtaaceetfcppppeikdgylvavkkqeyevseviyylcqktfyldgsns
vtcqangtwsatpvcrarckipaqrsrvlyngkklwiteipealvthfekvmffcrnkdq
qcsypaesrcfdgvlelpecyeeptwiqynffpknivseitscqgs
Download sequence
Identical sequences XP_002935040.1.99540 gi|301611019|gb|XP_002935040|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]