SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301611059|gb|XP_002935055| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301611059|gb|XP_002935055|
Domain Number 1 Region: 39-148
Classification Level Classification E-value
Superfamily Immunoglobulin 2.86e-16
Family V set domains (antibody variable domain-like) 0.0085
Further Details:      
 
Domain Number 2 Region: 261-333
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000166
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 170-249
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000158
Family C1 set domains (antibody constant domain-like) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301611059|gb|XP_002935055|
Sequence length 511
Comment PREDICTED: poliovirus receptor-related protein 1-like [Xenopus (Silurana) tropicalis]
Sequence
maprrngdccsrclwwpltisvlasvfqgvhsqmvlvnetvsgyigddvmlhcnfvnais
svkitqvtwqkstngskqnvaiynpsmgmailppykervsflspsfrdgtikltrlqled
egayicefatfptgnresqlnltvlakpvnhmegtskqliavpgstkkvvvatcisangk
ppssvnwetklkgeaefqeikhdngtvtvisryllvpnreahrqpltcvinyqterytqt
vllsvlyephvaiegfdgnwyvrrpevkltctadanpppslyewrmangslpdnaivnnn
tlhfrgevtygfsgtyiceaknaigsrtgqvevnvtefpftpttpgrmdrresstfptai
vggavggvvlvlavsvlifvvlrkrhhtfkgdyntkkhvygngyskagvaqhppmaqslq
ypedsddekkpgpvgsssyeeeddeegldrhklgpkyddeskrpyftveegerrcynedr
tlgfqyepddmpdslvpqndgsfiskkewyv
Download sequence
Identical sequences gi|301611059|gb|XP_002935055| XP_002935055.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]