SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301611165|gb|XP_002935121| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301611165|gb|XP_002935121|
Domain Number 1 Region: 592-890
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.1e-84
Family Protein kinases, catalytic subunit 0.000000000316
Further Details:      
 
Domain Number 2 Region: 1-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.93e-74
Family Ephrin receptor ligand binding domain 0.000000147
Further Details:      
 
Domain Number 3 Region: 300-505
Classification Level Classification E-value
Superfamily Fibronectin type III 4.51e-39
Family Fibronectin type III 0.00000435
Further Details:      
 
Domain Number 4 Region: 886-956
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.75e-21
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 
Domain Number 5 Region: 230-300,338-358
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000392
Family Growth factor receptor domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301611165|gb|XP_002935121|
Sequence length 962
Comment PREDICTED: ephrin type-B receptor 1-A [Xenopus (Silurana) tropicalis]
Sequence
mdtrtataelgwtanpssgweevsgydenlntirtyqvcnvfgpsqnnwllttfiprrga
hrvyvemrftvrdcsslpnvpgscketfnlyyyetdsnidnkistfwnespylkvdtiaa
desfsqvdfggrlmkvntevrsfgpltrsgfylafqdygacmsllsvrvffkkcpsvvqn
favfpetmtgaestslviargtcipnaeevdvpiklycngdgewmvpigkctckagyepe
nhvvckacpaamfkanqgmgvcapcpansrstseaspicicrngyyradfdtpeapctsv
psgprnvisivnetaitlewhppretggrddvtyniickkcqsdrrgcsrcddnvefvpr
qmgltdtrvfisnlwahtpytfeiqaingvtnkspfppqhvsvnittnqaapssvpimhq
vkatmksitlswpqpeqpngiildyeiryyekdhhefnsslarsqtntasieglrpgvvy
vvqvrartvagygkfsskmcfqtltaedykselreqlpliagsaaagvvfivslvaisiv
csrkrtyskeavysdklqhystgrgspgmkiyidpftyedpneavrefakeidvsfvkie
evigagefgevykgrlklpskreiyvaiktlkagysekqrrdflseasimgqfdhpniir
legvvtksrpvmiitefmengaldsflrqndgqftviqlvgmlrgiaagmkylsemnyvh
rdlaarnilvnsnlvckvsdfglsrylqddtsdptytsslggkipvrwtapeaiayrkft
sasdvwsygivmwevmsygerpywdmsnqdvinaieqdyrlpppmdcpaalhqlmldcwq
kdrnsrprfgeivntldkmirnpaslktvatipavpsqplldhsipditaftsvddwlsa
ikmgqyrdiflssgftslqlvaqmtsedllrigitlaghqkkilnsiqsmrvqisqspts
ia
Download sequence
Identical sequences gi|301611165|gb|XP_002935121|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]