SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301611346|gb|XP_002935194| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301611346|gb|XP_002935194|
Domain Number 1 Region: 601-906
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-82
Family Protein kinases, catalytic subunit 0.000000000495
Further Details:      
 
Domain Number 2 Region: 18-189
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.12e-71
Family Ephrin receptor ligand binding domain 0.000000383
Further Details:      
 
Domain Number 3 Region: 318-519
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-38
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 4 Region: 898-971
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.64e-22
Family SAM (sterile alpha motif) domain 0.00015
Further Details:      
 
Domain Number 5 Region: 244-318,356-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000255
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301611346|gb|XP_002935194|
Sequence length 974
Comment PREDICTED: ephrin type-B receptor 3-like [Xenopus (Silurana) tropicalis]
Sequence
MVPAVFVMLALSAVQGLEETLMDTKWTTSELAWVAYPDSGWEEVSGYDEASNPIRTYQVC
NVRDGNQNNWLRTQFIPRQDVQRVYVELKFTVRDCNSLPNIPGSCKETFNFFYYESDSDS
ASADSPFWMENPYMKVDTIAPDESFSRRDSGRVNTKIRSFGPLSRTGFYLAFQDLGACVS
LISVRVFFKKCPRTIAGFATFPETVTGAEATSLVIAPGTCVPNALEVSVPLKLYCNGDGE
WMVPVGACTCASGFEAAGKDTQCQACKRGTYKSKQGEGSCVPCPVNSRAISSAATICSCQ
NGYYRADGESAETACTSVPSAPRHVISNVNETSVVLEWAEPGHLGGRDDILYNVICKKCL
ERLCSRCDDNVQFWPRQLGVTQRRVSVSHLQAHTKYSFEIQAVNGVSGKSPHIPNYYTVN
ITTNQAAPSAVPMVQSHGSSANSLTLSWAPPESPNGIILDYEIKYYPKGQSGAGNTVTSQ
RTTVRMEAMTPDTVYVVQVRARTVAGYGAYSEPREFQTISEDGDRSSLQEQVPMVVGSVT
AGLIFIIAVVIIVIVCFSRKQRNDAESEYTEKLQQYMVPGMKLYIDPFTYEDPNEAVRDF
AKEIDISCVKIEEVIGAGEFGEVCRGRLKQAGRREQLVAIKTLKAGYTEQQRRDFLGEAS
IMGQFDHPNIIRLEGVVTRSRPVMILTEFMENGALDSFLRMNDGQFTVIQLVGILRGIAS
GMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLENSRSDPTYTSSLGGKIPIRW
TAPEAISYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCP
AALHQLMLDCWLRDRNLRPKFSQIVSSLDKLIRNAASLKVTSPAQAGVSQQLLDRTVPDY
TTFPTVSDWLEAIKMGQYQENFLSAGFTSFHLVAQMTAEDLLRIGVTLAGHQKKLLNSVQ
DMRLQMSQTLPVQV
Download sequence
Identical sequences gi|301611346|gb|XP_002935194| XP_002935194.1.99540 8364.ENSXETP00000037643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]