SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301611449|gb|XP_002935248| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301611449|gb|XP_002935248|
Domain Number 1 Region: 1329-1551
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 5.23e-83
Family Fibrinogen C-terminal domain-like 0.00000149
Further Details:      
 
Domain Number 2 Region: 1158-1323
Classification Level Classification E-value
Superfamily Fibronectin type III 3.41e-22
Family Fibronectin type III 0.00081
Further Details:      
 
Domain Number 3 Region: 1066-1155
Classification Level Classification E-value
Superfamily Fibronectin type III 7.38e-19
Family Fibronectin type III 0.0000373
Further Details:      
 
Domain Number 4 Region: 620-796
Classification Level Classification E-value
Superfamily Fibronectin type III 1.39e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 5 Region: 977-1066
Classification Level Classification E-value
Superfamily Fibronectin type III 4.92e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 6 Region: 796-884
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000178
Family Fibronectin type III 0.0000224
Further Details:      
 
Domain Number 7 Region: 888-975
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000401
Family Fibronectin type III 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|301611449|gb|XP_002935248|
Domain Number - Region: 501-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000186
Family Integrin beta EGF-like domains 0.083
Further Details:      
 
Domain Number - Region: 345-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000204
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 563-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000262
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 252-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000293
Family EGF-type module 0.088
Further Details:      
 
Domain Number - Region: 190-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0012
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 283-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00131
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 408-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.002
Family EGF-type module 0.087
Further Details:      
 
Domain Number - Region: 377-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00205
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 594-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00245
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 470-493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00258
Family Integrin beta EGF-like domains 0.085
Further Details:      
 
Domain Number - Region: 439-462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00293
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 315-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00617
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 532-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 222-245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0611
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301611449|gb|XP_002935248|
Sequence length 1559
Comment PREDICTED: tenascin-like [Xenopus (Silurana) tropicalis]
Sequence
mgvpiqvyaclifllsaevncglvrkiirqkresglnislpednqpvvfnhvyninvpmg
slcsvdldptstkdnelspevgknyqehnlngenqivfthriniprracgcasapdikdl
ltrleeleglvsslreqcttgagccssaqgvletkpycngrgnysseakacicepgwtgl
ncteimcpgqcnnrgvcvngacvcspgffgedcsevacpddcndqgkcvngrcvcfegyg
gedckeevcplpcgehgkcvngqcvcdenfigedcseprcpnncnnrgrcvdnecvcddp
ytgedcselicpndcfdrgrcvngvcyceegftgedcgqlacpnncnnhgrcvnglcvce
tgytgddcselacpdncnnrgrcingqcvcdegytgencgelrcpndcnnrgrcvngqcv
cddayigsdcsdlrcpndcnnrgrcvngqcvcdegfigddcgelrcpddcndrgrcvngq
cvcdegytgldcgelrcpndcnnrgrcengqcvcdeeftgedcselrcpndcnnrgrcvn
gqcvcdtlfmgddcgelrcpddcnnrgrcidgqcvcdegftgdncaeltcldnchnqgrc
idgqcvcdegftgdfcsevsppkdlkvidvttktmnlewqnkmrvneylvsyvptspggl
eldfrvpgdqtaatirelepgveyfvrvyailrnqksipvsarvsthlpttddlrfksvr
etfvdvewdpldisfdtwqlifrntkeengeittslerpvtsfvqtglapgetyevsiqv
vknktqgppltkvtttrldapsqvevndvtdtsalitwvkplaeidgislsygtenepit
tveltedetqysmnglrpdteyevtlisrrremtsspatetfttenipevgdlavsdvtt
nsfdlswkatsdsfeefvievidtnrlfepitlnvsgnlrtssvsgllpktdysislfgi
vhglrtqaistsattepepevgnllvskitsdsfhlswnadesgfdnfilkirdakqqfe
pitltvpgsersslvtglrdgteydielvgvasgqrsppikgmattalgspkglsfsdit
ensakvtwvaprirvekflityipvsggspntvevdgsktqstlvnlhpgveyivsivsv
qgseesepasgtfttaldspsglkvvnitesdalalwqpslasvdnyvfsysaknapavt
hsisgntvendliglhpsteytvkvyavrgqhrsaeistkfttaldgprdlsaseiqses
alltwkpprstitgyvliyesvdgtvkevvvgpdttsyrlldlspsaqyiarvqaingdr
rskeiqtifitigllypypkdcsqallngeadsglytiyvngdqsqpmevycdmsvdggg
wivflrrtdgseefyrnwktysagfgninneffmglenlhkltslgqyelrvdlrdndet
ayavydkfsvgdaksrfrlkvegysgtagdsmtyhngrsfstfdkdndsaitncalsykg
afwyknchrvnlmgrygdtnhsqgvnwfhwkgheysiqfaemkirpvsfrnlegrrkra
Download sequence
Identical sequences gi|301611449|gb|XP_002935248|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]