SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301611557|gb|XP_002935293| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301611557|gb|XP_002935293|
Domain Number 1 Region: 39-536
Classification Level Classification E-value
Superfamily Sema domain 1.7e-178
Family Sema domain 0.0000000000211
Further Details:      
 
Domain Number 2 Region: 532-584
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000349
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 598-676
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000362
Family V set domains (antibody variable domain-like) 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301611557|gb|XP_002935293|
Sequence length 776
Comment PREDICTED: semaphorin-3D-like [Xenopus (Silurana) tropicalis]
Sequence
mkekhqkylgrwlkpqhsstmlsmvllmflpatdslkqniprlklsykdlllsnscvpfl
hplteglefqtllldeergklllgakdhiylldlvdlnknlrkihwpaakekiefckrag
kdnnlecanfikvlhhynkthaytcgtgafhplcgyvelgtpkeevvfqldtqnlesgrl
kcpfdpqppfasimtdeylfagtasdflgkettftrsmgpppdhhfiktdtddhywlnga
kffgayaipdtynpdddkiyfffresspegsfseksvfsrvgrvckndiggqrslinkwt
tflkarlvcsipaqdggdtyfdelqdifllptkddrnpvvygiftttssifkasavcvys
madiravfngpyahkespdhrwvqydgripyprpgtcpsktydptirstkdfpddvinfv
knhplmykavyplhgkpvftrlnvdykltqiavdhvvaedgqydvmflgtdigtvlkvit
vtkdiwnmeevlleemqifkqpaaitnielslkqqqlyitsevglvqlslhrcdtygkac
tdcclardpycawdgnscsryvptskrrarrqdvkngdpltqcwdvedntnqepaeekvi
fgiennstflecmpksqqasirwfiqhtgeehqeeitsderiiktdygllirslqkkdsg
myyckaqehtfihtitklnvkiieneqmentqkleddegrsrdlitesrlrykdylqlls
spsfsldeyceqmwhkekkrqrnkggakwkhvqeikknrnrrhheqrnqwarilsa
Download sequence
Identical sequences gi|301611557|gb|XP_002935293| XP_002935293.4.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]