SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301611657|gb|XP_002935348| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301611657|gb|XP_002935348|
Domain Number 1 Region: 42-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000681
Family EGF-type module 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301611657|gb|XP_002935348|
Sequence length 160
Comment PREDICTED: protransforming growth factor alpha-like [Xenopus (Silurana) tropicalis]
Sequence
myvpsagesmilllgfllaacqalenttsqlsdppvaaavrshfndcpvshsnycfhgtc
rfivqedlpacvcqpgfvgtrcehadllavvaannkkqtitalvvvsivatavligtcml
ihccrirkqcqwcravfcqhekpgsflkggvsccksetvv
Download sequence
Identical sequences XP_002935348.1.99540 gi|301611657|gb|XP_002935348|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]