SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301611698|gb|XP_002935370| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301611698|gb|XP_002935370|
Domain Number 1 Region: 156-251,296-407,446-552
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.7e-36
Family LacY-like proton/sugar symporter 0.041
Further Details:      
 
Domain Number 2 Region: 579-632
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000043
Family Ovomucoid domain III-like 0.0089
Further Details:      
 
Domain Number 3 Region: 677-794
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000955
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301611698|gb|XP_002935370|
Sequence length 879
Comment PREDICTED: solute carrier organic anion transporter family member 5A1-like [Xenopus (Silurana) tropicalis]
Sequence
maleshnaqaltasyqpecndheskdgpreyvesyrslslpvlngcrstachglewkvvd
ttqtnltqdkkmflhsfqgnidaqgrlssdisskshasptrtaisfqntsllgtgyteri
epningskqkelsqssqsssiksrkgvvialtdsrcflvcmcfltfiqslmvsgylssvi
ttierryslkssesgllvscfdigsllvvvfisyfggkgrrprwlaiggllialgaalfs
lphfisppyqiqelnasvaneglcmngnttakdslessmcpresggkdhslyvalficaq
iligmgstpiytlgptylddnvkkdnaslylaimyvmgalgpaagyllggvligfyvdpr
siihieqsdprfignwwsgfllcamamllvifpmftfpkklpprqrkkkkkkgnsydvss
eddvlkekssnkskadanpgpsigfgknfkdlpraavrilsnmtflfvslsytaesaivt
afitfipkfiesqfgipassasiytgliivpsagvgivlggyiikklklgaresaklami
ccgvsllcfstlfivgcdsinlgginipyttgptltmthrnltggcnvncgckiheyepv
cgsdgityfnpclagcvsvgnhsvavrnytecgcvqsrqvitpptvgqrsqlrvvivkty
lnengyavsgkcdrtcntlipfliflfivtlitacaqpsaiivtlrsveegerpfalgmq
fvllrtlayiptpiyfgavidttcmlwqqdcgvqgscweynvtsfrfvyfglaaglkflg
fififlawysikhkedqlqrrrwraspistvsemvsnvtagqnyartrscptfgareepn
enininrgiqhtaqtypgpfleainssfensqeeapaet
Download sequence
Identical sequences gi|301611698|gb|XP_002935370|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]