SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301611904|gb|XP_002935466| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301611904|gb|XP_002935466|
Domain Number 1 Region: 568-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  gi|301611904|gb|XP_002935466|
Domain Number - Region: 836-1095
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0284
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301611904|gb|XP_002935466|
Sequence length 1125
Comment PREDICTED: hypothetical protein LOC100490769 [Xenopus (Silurana) tropicalis]
Sequence
mtglhaavlryikhktynnakakwlqfgpnlelsnnigqdqvgsrgqnqegsqgqdqegs
rgrnqegsrgriqegsrdqdqegsrgqdqegsrgrnqeasrgqdqegsrgqnqggsrgqa
keeaevrtkkeaedpscilqrstyqlleascqsnetklhvenitnsasqilsdsswsnls
ssafsamvnglletvelsvlesfsktptnrnfsspeidvatkvaeencsfltitvglnsm
qvscdllpkpedgavfisyknlgsrlsgsflklsedpednnpavvnsqvvtggitsqtre
nlnppvsfylnnlqedrglhqvsriglgisvlclflslvtfllcrslrsahtsmlialcg
clflgqliilfglpqtgvkilcsiiagclhyillcafcwmtlesvllfltvrnlnamnyl
tsrrshfptaciigfgvpavivaisagvrsdgygtgkrllafkalvqlfilgstwilgff
qcgpgaivasylfticnslqgafiflvhcllnhqvreeyrkvfhrlhvqkpesegvsgst
vpmtlksvsltlpltaialsaatlliapsylsadinecqqnagicgtkaecnntmggykc
tcdsgyqtkanktefchnenytkceaadalsprtsppatvitstifpatdpitcpagyvv
sstgkgmecsdvatkvaqencsfltitvglnrmqvscdllpkpkdgavfisyknldsrls
gsflklsedpeenypavvisqvvtggitsqirenlnppvnfylnnlqvpdssqislcvyw
dpklggwsqrgcniifsnishtvcscdhlstfavimapcdikedrglhsvsriglgvsvl
clflslvtfllcrslrsahtsmlvalcgclflgqliilfglhqtqfrilcsiiagclhyi
llcafcwmtlesvllfltvrnlnamnyltsrrshfptaciigfgvpavivaisaavrydg
ygtgkscwlslnliwsflgpvcvfitinttlliltfwllrvklaslntnvsslkntrlla
fkalvqlfilgstwilgffqcgpgaivasylfticnslqgafiflvhcllnhqvreeyrk
ifrrfhikkpesegvsgstvpmslksvtapeelkpdiiidhpfed
Download sequence
Identical sequences gi|301611904|gb|XP_002935466|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]