SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301611990|gb|XP_002935502| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301611990|gb|XP_002935502|
Domain Number 1 Region: 370-544
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.8e-40
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.011
Further Details:      
 
Domain Number 2 Region: 165-378
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.87e-29
Family beta-glycanases 0.0058
Further Details:      
 
Weak hits

Sequence:  gi|301611990|gb|XP_002935502|
Domain Number - Region: 526-620
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0136
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301611990|gb|XP_002935502|
Sequence length 627
Comment PREDICTED: alpha-L-iduronidase-like [Xenopus (Silurana) tropicalis]
Sequence
metlslvlllcalqgiivygtciikidptkgrkqlkhfwkstgfciplphdksetyflgk
dqqlnlayissiplkgieqvrvhwlldlvtvsflvsksarcpssnfevislqlrvrgleh
pdhcrtllflldltctaarvedkvvlsvllsyeflkgcqriqnigfelmgspsgyftdfe
dkqqvmewrnlifrtaqryikkygllqvsqwnfetwnepdnhdfdnvsvtingfqnyyda
cseglkqgaggsfyileqeietvneiqkrfplfknvpiyndeadplvgwstpqswrgdvt
yaamvvkiidqhlqllsnksnsinysllsndnafmnfhphyfsqrtltarfqmnntnpph
vqmvrkpvltvmgflallgevqistevlitdsnaknsniigaigsthepekgeladswqs
tilcyasddnktsptinsitvnmtnfpkskdlvyvtyyldnnltnpfvewqkvgspdfpt
ikqfqqirdmedpirkgpiafpkdgnlllkvqlpipsvflihicekphsapnkvtglhfl
pltkgevaviwsdehitsrclktfevefsetgstygrinkkdtmfnlfifspesavvsgs
yrvrainywdvpglyslpqqytetllq
Download sequence
Identical sequences gi|301611990|gb|XP_002935502|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]