SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301612080|gb|XP_002935540| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301612080|gb|XP_002935540|
Domain Number 1 Region: 21-409
Classification Level Classification E-value
Superfamily Sema domain 3.53e-94
Family Sema domain 0.0000848
Further Details:      
 
Domain Number 2 Region: 1296-1423,1607-1793
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.06e-37
Family p120GAP domain-like 0.02
Further Details:      
 
Domain Number 3 Region: 771-865
Classification Level Classification E-value
Superfamily E set domains 1.2e-16
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 4 Region: 416-467
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000235
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 862-953
Classification Level Classification E-value
Superfamily E set domains 0.0000000000043
Family Other IPT/TIG domains 0.03
Further Details:      
 
Domain Number 6 Region: 951-995,1026-1076
Classification Level Classification E-value
Superfamily E set domains 0.0000049
Family AMPK-beta glycogen binding domain-like 0.094
Further Details:      
 
Weak hits

Sequence:  gi|301612080|gb|XP_002935540|
Domain Number - Region: 419-448,553-603,708-774
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000138
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 1090-1146
Classification Level Classification E-value
Superfamily E set domains 0.00513
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number - Region: 1425-1479
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0145
Family Ubiquitin-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301612080|gb|XP_002935540|
Sequence length 1826
Comment PREDICTED: plexin-B1-like [Xenopus (Silurana) tropicalis]
Sequence
mlglapfllsflcnclpvssvpsflrpnvtfnhmardptsgfiyigavnwifqlssdlql
lledstgpredspeclpfkdlkdcrqatltpntnkllavnthggelitcgqvfqgicekr
rlsnisdiifqtidpgdnqfvaandpkvttvgivegpsenhqllfvgrgltarlssgipp
itirqlektpvfsneglgklvvgdfsdynntfvgifsnnghvyflffrrgsksqmdynty
lgsvctgdvhlysyvevplvcqggynlaqaayletgnrelfvvfaasqgptpnpssrtal
csykmvdiesrienaremcytnagmgndkeeavieygvnskcgklskdtpqlfqcggeht
pspiasrvpveatpllkdlssltavaalaedtytiaflgdaagnihkvtkmpvaecstfs
scdsclaardpfcgwcvlqgrcmakqqcvdyteenhylwsydkeatclaieditpanqsr
tqqrlvtltvpglpsveeqsswkclfddisneaivhgshvtcwtplpnvlppnqpgkdhv
vmrlallfenitiaemnfsfydceavmklvvnapcagcvnsqwechwcvndyrcihdtqn
csqdqviifnqrlggpdacpriesvdgstlipvgvereldligrnlqllkeevlgyscvi
dahgttttlpaqienvtgekdvfqvhcqthkfeyslrtlehqvtiyvmtgdghrvddked
iqvvlyncsvgqsdcsrcqalhnqyncvwctkmegeaclhesecqhsamdtcptptiysf
spmtgiiqggttititganmgqkaedvsvkvashpctllpdlyiisnrivctlsasnaee
sgpvevyvdalqpgvsvehftyqdpvlqslhplqgpiaggtlititgsklltgdlinitv
gdipckipnggvaegeihcvtgassvleelpvsvfygsakriledtkysytenptislvy
psrcfygggrviwvegtnldvvktpvmtvlaklsskelgeddgsarrkrrkrwgrraldh
egikefsgpcslnsssllkcfspsisetfelvdvlfildnlripfsstrenftyiknptf
kplnrespskpynlkpgnvldiegegldygiskqevgatigngicivktlthnhlycepp
pespqpldlstslpefvvhmgnlqfnlgqvkydvdgqtafpkeakiglavvatllvpivl
iiiymyrrqskmamrdykkvlvqlenletrvgdqcrkeftdlmtemmdlsselegsgipf
ldyktyveriffpvnidspipksldvpagrrstveqgltqlsnllnnklfltklietlda
qltlsqrdrchaaslltvalhgkleyltdvmktllanlidqcvaknpkllfrrtetivek
lltnwmsiclqtdlreaaaeplymlycaikyqvdkgpvdavtgkakrtlndchllredid
yhpmtltvivksgrethhvpvrvldtdtitqvkqkilnqvykgtpfsqrpaattldlewr
sgnaghltlsdedltsliqdqwkrlntlhhykvpdnatvaliprlhnnqcetpsnsfigg
ektpmledgdeggirtwhlvkpveepevfknrksslrererakaipeifltrllsmkgtl
qkfvddafqvmlgvnrqvpiaikyffdfldemaekheitdaetvhiwktnslmlrfwvli
lknpqmvfdvevsenvdsilaviaqtfidsctisehkvgrdspvnkllyareiprykqlv
enyyadikktaaasyqemnsflteqsgvhstelnslvalqelynyinkyydqissaleed
pngqkmqlayrlqqisalvenkvtdl
Download sequence
Identical sequences gi|301612080|gb|XP_002935540|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]