SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301612214|gb|XP_002935617| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301612214|gb|XP_002935617|
Domain Number 1 Region: 484-729
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.82e-62
Family Nuclear receptor ligand-binding domain 0.0000000017
Further Details:      
 
Domain Number 2 Region: 361-438
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-23
Family Nuclear receptor 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301612214|gb|XP_002935617|
Sequence length 731
Comment PREDICTED: progesterone receptor-like [Xenopus (Silurana) tropicalis]
Sequence
MEETGQRSGTSSEPPGQQVPVLLPQQPPEPGDTPLGSLLYQRPGHGSSYHKGEGPSSPDN
NELEDVLDSLLDSSVSSHLHPWTHFAAPEVPTLIVTPHMCPSDKTKALTTFPEETSLWAE
PTLGERKELGDSVPPGSLEETKGLNSPVAMDSDEPVTSILPLLPPELNLTNMPILPLNPA
YLAARARQILGFEESGQRSSPDTSQTSIPYTNLQSNMKQSSYFHPELPPDSRIKKESSVV
SLYKGKESSLCQDYGSSPRNPSTPDPLPSLDFILYKNDPTCDYDSCGASHGNEGGDPGRV
LPSTSAQTIYQPLGLNGHQHVSYQPALMKETYLPEIPLPYVPYIRSDGDPDQGGPYETLA
QKVCLICGDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIVDKIRRKNCPSCR
LRKCCQAGMVLGGRKFKKFGRIKTGREIDALVLPSPPTLFVECQQILTRRISNSSAQEIQ
FTPELLQILQSIEPEVVYAGYDNTQPETPSALLSSLNQLCERQLVCVVKWSKSLPGFRNL
HIDDQITLLQYSWMSLMVFAMGWRSYQHVSGQMLYFAPDLILNEQRMKDSSFYTLCLSMW
QLPQEFMKLQVTHEEFLCMKALLLLNTIPLEGLKSQTHFDDMRSNYIRELAKAIGLRHKG
VIASSQRFYQLTKLMDSMHELVKQLHLYCLNTFLQSRSLSVEFPEMMSEVISAQLPKILA
GMVKPLIFHKK
Download sequence
Identical sequences F6V3Y1
XP_002935617.1.99540 ENSXETP00000012055 ENSXETP00000012055 gi|301612214|gb|XP_002935617|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]