SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301612380|gb|XP_002935703| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301612380|gb|XP_002935703|
Domain Number 1 Region: 124-415
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-90
Family Nuclear receptor ligand-binding domain 0.0000000127
Further Details:      
 
Domain Number 2 Region: 21-108
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-28
Family Nuclear receptor 0.00000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301612380|gb|XP_002935703|
Sequence length 420
Comment PREDICTED: vitamin D3 receptor-like [Xenopus (Silurana) tropicalis]
Sequence
MEFMATTSISDTDMEFDKNVPRICGVCGDKATGFHFNAMTCEGCKGFFRRSMKRKAVFTC
PFNGDCRITKDNRRHCQSCRLKRCVDIGMMKEFILTDEEVQRKREMITKRKEEEALKESM
RPKMSEEQQKMIDVLVDAHRKTFDTTYSDFGQFRPPVRENVCKRITRSSSILTQGSSSED
SDVFTSSPDCSEHGFFSAGSLFGHFEHSSMDGKAGDLSMLPHLADLVSYSIQKVIGFAKM
IPGFRDLIAEDQIALLKSSVIEVIMLRSNQSFSLDDMSWTCGSEDFKYKVDDVTQAGHNM
ELLEPLVKFQVGLKKLNLHEEEHVLLMAICILSPDRPGVQDKALVESIQDRLSATLQTYI
LCKHPPPGSRLLYAKMIQKLADLRSLNEEHSKQYRSISFLPEHSMQLTPLVLEVFGNEIS
Download sequence
Identical sequences F7B2T2
8364.ENSXETP00000023342 gi|301612380|gb|XP_002935703| ENSXETP00000023342 ENSXETP00000023342 XP_002935703.1.99540 XP_012813296.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]