SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301612730|gb|XP_002935869| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301612730|gb|XP_002935869|
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.31e-19
Family FHA domain 0.0058
Further Details:      
 
Weak hits

Sequence:  gi|301612730|gb|XP_002935869|
Domain Number - Region: 1177-1254
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0811
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301612730|gb|XP_002935869|
Sequence length 1468
Comment PREDICTED: centrosomal protein of 170 kDa [Xenopus (Silurana) tropicalis]
Sequence
msltswflvssggtrhrlpremifvgrddcelmlqsrsvdkqhavvnydsssdvhmvkdl
gslngtfindvripeqtyitlklddklrfgydtnlftvvrgemrvpeealkhekfssqlh
faqkppeterskktasrssdlkvndtpvevvqktvenvkseeklvdlsavhrgtplygqp
swwgdddssenkhhckvfhepgasgynkdtkkdrdegtagkeetlfllcrepsyfeiptk
espqksdveeniiheiptkdthcshalgaghasftiefdenspgkvtikdhvtkftpdyr
qkskktspscakdlsalqtemlaaeskvadwlaqnnppclrkevpeedtksiksdvpvyl
krlkghthddgtqsdyensgahkrfnkctnldehlrprnleqtklnikfhssgkhqetsq
tsgtsshrvihstqhaklllkqkseepcaplmlsqnvllrssgslghrpnkkrvigdele
ipsvsdcnkrhvddqgdkvryankwdllnqeetdpskmidkeasslcgkkrwvsqwasla
snhighdqengrfesdvpaavendadlsvksngsaasltcqndrvrrtlplvpkeeikvs
nskgayhrseigekqdtelqeketpthapkkdnlnlletraitkknhmgddntlkleskp
khdqaehnqrsssrssskqvtvkpikpkddsktqkaylsskspviqsnhtddgrktetvs
ntqslktvesdrkdttkplvrqgsftidkpstnvpieliprinkltgssptlasvtnire
rsdsvdtdssmdttlllkdteavmafleaklrddsktddgpetpsynqdnsispesdvdt
astislaagdaekkcpqkrktfsslyketsssaskdfskspslnrekidkknkvrahevs
srteirktlqasqrnkqppagcvtddqtsrlssvsdivssdqetysgrsaskcefnvade
plhskttkdksalvksapssksvtlprprptrtsllrrsrlgeasdseigdadkasvase
vsttsstskppsgkkalsridllaqprrtrlgslsarsdseatisrspgssrtpestfrs
glkslpptdvkgstraransisrlsdtktsthsspplnvrwrrttpeyastsedefgsnr
nslkptrlrtspaksqrlhstgigtavqpatlnasifkhrvkeqedyirdwtahreeiar
isqdlaliareindvageidsvtssgtapsttvstaattpgsaidtreelvdrvfdesln
frkipplnqsrtaeanfrsgdpkppqkeisepqaitrrktwsrdeamgdslllssvfqfs
rkirqaidktankirilfkdkernwdeiekklraeseipifktscveilsilqelkrvek
qlqvinamidpdgtlealnilgfsnsispveikqnqshvicsarsstrtsqpnitsasse
fsvesdpdfaihfnrfnpdgkedttlhe
Download sequence
Identical sequences gi|301612730|gb|XP_002935869|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]