SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301612961|gb|XP_002935996| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301612961|gb|XP_002935996|
Domain Number 1 Region: 362-497
Classification Level Classification E-value
Superfamily TIMP-like 9.73e-29
Family Netrin-like domain (NTR/C345C module) 0.049
Further Details:      
 
Domain Number 2 Region: 144-239
Classification Level Classification E-value
Superfamily Immunoglobulin 3.39e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 315-369
Classification Level Classification E-value
Superfamily BPTI-like 3.97e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 4 Region: 254-312
Classification Level Classification E-value
Superfamily BPTI-like 1.25e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0091
Further Details:      
 
Domain Number 5 Region: 58-108
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000374
Family Ovomucoid domain III-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301612961|gb|XP_002935996|
Sequence length 506
Comment PREDICTED: WAP, kazal, immunoglobulin, kunitz and NTR domain-containing protein 2-like [Xenopus (Silurana) tropicalis]
Sequence
miqlqecetyekccpnvcgskscvaarymdvkgkkgpigmpkgatcdlfmctqqgsecdi
wdgqpickckdrcekepsftcasdgltyynrcfmdaeactkgitltvvtckyhlswpnts
papfqttsnptiasletafkngipptlvnnpvekvvdvgdtvsfhcdvtgkptpeitwek
qvdgkenvimrpnhvvanivvtniaqlviyntqlqdagiytctarnaggiikvnfplsvn
elpakekstnktffptdeclkppdsddcgeeqtrwyfdakknncfifiygncnsnynhfd
tyescmltcmngpvnvcnfpalqgmckaykprwaynkqlkqcqsfiyggcggndnnfetk
etcedmcpfpknqkckickprqklvtsfcksdftilgritelteefdsghalvsveevlk
dekmglkflgkepleitllnidwscpcpnvtlvnsqliimgdvhngmatlqphsfvgtss
arrirklreviynktcdllkeilgqp
Download sequence
Identical sequences gi|301612961|gb|XP_002935996|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]