SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301613114|gb|XP_002936047| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301613114|gb|XP_002936047|
Domain Number 1 Region: 125-372
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.13e-67
Family Nuclear receptor ligand-binding domain 0.0000000197
Further Details:      
 
Domain Number 2 Region: 57-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.42e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301613114|gb|XP_002936047|
Sequence length 458
Comment PREDICTED: hepatocyte nuclear factor 4-beta-like [Xenopus (Silurana) tropicalis]
Sequence
mklceammdmdmpdytetldssytmlefdsirvlpsnteiitvetaspgllnngisafca
icgdratgkhygasscdgckgffrrsvrknhvyacrfsrqcivdkdkrnqcrycrlrkcf
ragmkkeavqnerdrismrrssyedngslsisvltqaeamvlqysplspahssdismkkv
asisdvcesmkqqllllvewakyipafcelplddqvallrahagahlllgvakrslpykd
flllgndfimpmhcpelevarvacrildelvkplreiqiddneyaclkaiiffdpdckgl
sdqtkvknmrfqvqvnledyindrqydsrgrfsdillllpplqsitwqmieqvqfaklfg
varidsllqemllggsamdgsqyshsghsglnldllsgptvhphnlhsvihtvsssspet
slpspstnpnsedykmntatvssiplmprsviakkeil
Download sequence
Identical sequences gi|301613114|gb|XP_002936047| XP_002936047.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]