SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301613191|gb|XP_002936101| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301613191|gb|XP_002936101|
Domain Number 1 Region: 52-119
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 149-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000168
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 3 Region: 117-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000914
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301613191|gb|XP_002936101|
Sequence length 199
Comment PREDICTED: hemicentin-1-like [Xenopus (Silurana) tropicalis]
Sequence
mqstllekpenvqtyrteteskapkvattpvkvidylhsgskrkyfrrrsyctyppvpth
gtfrfltmidpspyqyqyyiqyscypgytmsqgdvfsfclengkwtgvtpvceepvpcsv
dnggcsqickshgegqaecackmgfqllsdmrtcrdidecssemrlcehdctntfgsyqc
scwkgftlteggrtcipyt
Download sequence
Identical sequences gi|301613191|gb|XP_002936101|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]