SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301613354|gb|XP_002936178| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301613354|gb|XP_002936178|
Domain Number 1 Region: 935-1041
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00073
Further Details:      
 
Domain Number 2 Region: 293-395
Classification Level Classification E-value
Superfamily SRCR-like 4.32e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 3 Region: 399-504
Classification Level Classification E-value
Superfamily SRCR-like 5.1e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00029
Further Details:      
 
Domain Number 4 Region: 617-721
Classification Level Classification E-value
Superfamily SRCR-like 1.19e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00024
Further Details:      
 
Domain Number 5 Region: 83-187
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00028
Further Details:      
 
Domain Number 6 Region: 505-614
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00023
Further Details:      
 
Domain Number 7 Region: 723-827
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00062
Further Details:      
 
Domain Number 8 Region: 189-292
Classification Level Classification E-value
Superfamily SRCR-like 6.67e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00038
Further Details:      
 
Domain Number 9 Region: 1037-1146
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0014
Further Details:      
 
Domain Number 10 Region: 831-935
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301613354|gb|XP_002936178|
Sequence length 1414
Comment PREDICTED: deleted in malignant brain tumors 1 protein-like [Xenopus (Silurana) tropicalis]
Sequence
mhgipwfyhikdlgvicrgslafnhppeayksppkkndisffgnsdfwnyydglefeydl
dpvaaseisldpvsifnvwykleelklvggasrcegrvmvrfygewgsmcnyrwdikeas
vvcrqlgcnnspgqhkaasfgpgsgnlwlshvkctgdeftlseckrnltlfhncdhtadv
gvicagggplelrlaggsnrcegrvevkhhgewgtvgdffwdnkaamvvcrqlgcntsye
qatsfgagtgkiwfsglkctgnesalwdcepelnryriwnntadvgvicagepeelrlvg
gtndcegrvevkhrgewgtvcgndwdtrdaavvcrqlgcntslikattfgggsgkiwlsh
lqctgketslweckhgmwglhycnhsqdvgvicegadenvrliggdnecegrvevkhqgt
wgtvcgrqwgakeasvvcrqlgcntsneyfstkatffgagsgriwlsnvkctgdepslar
ckhntwgiekcdhtedvgvictgepeelqlvggnnecegrvevthrgvwgavcdhnwnqk
aasvvcrqlgcnnttkgymkaqaaffgqssrnislsrvkctgeeavlwecqhqmwglsnc
lhradvgvickgepdllrlvgggtncagrvevkhrgewgtvcddfwnenaaevvcrqlgc
stsyedtahikatpfgaasgkiwlsrvrckgeesslrdcdhnmwglhycshsedagvicg
gpysgfrlvngtqrcsgrvevlytgqwgalcksnwdlhaanvlcrqlqcgtavfipdrry
fgksdfvwtdrfhckgteshlgecsfaalgnsdcsrddlagvvctgkeelmrlvdgeshc
egrlevlqnstwfsvtgeqwglkeaqlvcrelhcgearsaftaeaqsaagtlvtwsdikc
kgnennltdcplmpqpssvpyangknhvgvicsesllirlvdsphrcagrvevyhqgewg
ticgdswdkadanvvcrqlncghaisistmshketgkvtawlsginctgsetalwqcpfn
nwgqhsctkkqdarvkcseftdlrldggshecegrlevyyngswrsvcnnhmdqvsisvi
crhlncgtkgirpitftygaadppywldlikcrkhdqsfwqcpsspwakhscnlqaevae
ikcegerkkplhnqsetyglpalqncsnvqtlieslishsttsiptaiaivfgillflal
iglwilkknlkvlkkgkrssmcrddeiyeeieanlmmpmdkeanlspgsaeiiqddyddv
eeqvkkslsstsdtertaeiiqdgyddveeqvkktlsldsgsestsetfnqdkyddvevl
hqkesksqdnyddaevpnqmgfdisgslakeknledgyddaavgllsshaskaerirgag
sdtglptqdapedvthehqipliietgyedsgfi
Download sequence
Identical sequences gi|301613354|gb|XP_002936178|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]