SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301613356|gb|XP_002936179| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301613356|gb|XP_002936179|
Domain Number 1 Region: 1828-1931
Classification Level Classification E-value
Superfamily SRCR-like 9.02e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00048
Further Details:      
 
Domain Number 2 Region: 1183-1288
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00039
Further Details:      
 
Domain Number 3 Region: 489-594
Classification Level Classification E-value
Superfamily SRCR-like 1.12e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00026
Further Details:      
 
Domain Number 4 Region: 226-329
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00028
Further Details:      
 
Domain Number 5 Region: 1087-1179
Classification Level Classification E-value
Superfamily SRCR-like 1.16e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00035
Further Details:      
 
Domain Number 6 Region: 1400-1505
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00028
Further Details:      
 
Domain Number 7 Region: 1613-1718
Classification Level Classification E-value
Superfamily SRCR-like 1.01e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00068
Further Details:      
 
Domain Number 8 Region: 876-981
Classification Level Classification E-value
Superfamily SRCR-like 1.1e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00027
Further Details:      
 
Domain Number 9 Region: 709-815
Classification Level Classification E-value
Superfamily SRCR-like 9.29e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00085
Further Details:      
 
Domain Number 10 Region: 597-705
Classification Level Classification E-value
Superfamily SRCR-like 1.01e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00029
Further Details:      
 
Domain Number 11 Region: 1289-1397
Classification Level Classification E-value
Superfamily SRCR-like 5.23e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00028
Further Details:      
 
Domain Number 12 Region: 983-1086
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00038
Further Details:      
 
Domain Number 13 Region: 123-225
Classification Level Classification E-value
Superfamily SRCR-like 3.14e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0004
Further Details:      
 
Domain Number 14 Region: 1930-2026
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0017
Further Details:      
 
Domain Number 15 Region: 1722-1826
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0021
Further Details:      
 
Domain Number 16 Region: 330-411
Classification Level Classification E-value
Superfamily SRCR-like 1.15e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0023
Further Details:      
 
Domain Number 17 Region: 1502-1613
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0042
Further Details:      
 
Domain Number 18 Region: 415-493
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301613356|gb|XP_002936179|
Sequence length 2278
Comment PREDICTED: deleted in malignant brain tumors 1 protein-like [Xenopus (Silurana) tropicalis]
Sequence
msvlrldyhrttpeaadaiasrllfpaspsaaahlpflqrgghsqvigasgqpchygilp
tayisppygldsavhlccferkvykvddtpgssenisslsseeepgsswgpdlegikpdm
pedirltggatecegrlevkyrgewgtacsdswdlkeaavvcrqlgcihsqedvahvkaa
yygsgtgiiwhrglncsgnesylweckdartfcnhdlvgvicsgepeelrlvgratdceg
rvevkhrgewgtvcghnwgleeatvvcrqlgcnsslikassfgagsgkiwvghprctgke
talwkcnhrmwglhycahhedvgvvcagepedvrlvggstkcegrvevkhrgtwgtvcsd
gwnynaaltvckqlgckplhepvhniyfgagegriwlsglsctfedqvlwdysledlrlv
gganqcegrvevkmkgqwgtvcggdinreatvdavicrelgcnstniqatsfgagsgksl
lydvscepeelrlsagshkcegrvevkhhgewgtvcsrewdwsetdvvcrqlgcgvsgpl
grsisaffgagsgkiwlaglsctgeesalwdcrhpmwghhncdhrddvgvrctakpeelr
lvggsfrcegrlevkiygqwgtvcnehwnyyrtearvicrqlgcytsakspffikatsfg
agsgniwfhrvhcsgdekalgdcitepwnpgdcshsadvgvicagapeglrlvggenece
grvevkfqgvwgtvtssnwdvaaasvvcrqlgctpspteivksvsfgpgtgkiwfnvisc
lgkeeslwnckiemrgipwfdhikdlgvicrgswafnhlpeaykymeyviqnvdipdigi
ymraikneyvavpvaaneipqdsfsifndllstdkleelkleggisrcegrvmvrsygew
gsmcdyrwdmkeatvvcrqlgcnnspgqhkaasfgsgsgkvwlsqvkctgdeftlseckr
nltlfhncdhtadvgvicagggplelrlaggsnrcegrvevkhhgewgtvgdffwdnkaa
mvvcrqlgcntsyeqatsfgagtgkiwfsglkctgnesalwdcepelnryriwnntadvg
vicagepeelrlvggtndcegrvevkhrgewgtvcgndwdtrdaavvcrqlgcnssliki
wlshlqctgketslweckhgmwglhycnhgqdvgvicqgadenvrliggdnecegrvevk
hqetwgtvcgrqwgakeasvvcrqlgcntsneyfstkatffgagsgkiwlsnvkctgdep
slawcmhntwgiekcdhtedvgvictgepeelrlvggdnecegrvevkhrgvwgavcdhn
wnqkaasvvcrqlgcnntteghmkaqaaffgqssrnislsqvkcteeavlwecqhqmwgl
snclhradvgvickgepdllrlvggatncagrvevkhrgewgtvcddfwnenaaevvcrq
lgcstsyedtvhikatpfgaasgkiwlsvvrckgeesslrdcdhnmwglnycshiedagv
icgdhreprlvdgpnscsgnlevkhggtwgsvceiddelrtarvicrelgcgpavpapwk
ydnndknvksaqiwtekikctgnesslfechrvprpartctdpssptihclgpysgfrlv
ngtqrcsgrvevlytgqwgalcisnwdlhaanvlcrqlqcgtavsipngryfgksdfvwt
drfhckgteshlrecsfaalgnsdcsrddlagvvctekeelmrlvdgeshcegrlevlqn
stwfsvtgeqwglkeaqlvcrelhcgearsaftveaqsaagtlvtwsdikckgnennltd
cplmpqpssvpyangknhvgvicsesllirlvdsphrcagrvevyhqgewgticddswdk
adanvvcrqlncghaisistmshhetgkgtawlsginctgsetalwqcpfnswgqhsctk
kqdarvncseftdlrldggshecegrlevyyngswrsvcnnhmdqvsisvicrhlncgtk
girpitftygaadppywldlikcrkhdqsfwqcpsspwakhscnlqaevaeiklqtlies
lishsstsiptavaivfgilflaliglwilkknlkvlkkgkrspmcpddeiyeeieanlm
mpmdkeanlspgsaeiiqddyddveeqvkktlsstsdtertaeiiqdgyddveeqvkktl
sldsdsestsetfnqdkyddvevlhqkesksrdnyddaevpnqmgfnisgslakeknled
gyddaavgllsshaskaerirgvgsdtglptqdapedvthehqipliietgyedsdfi
Download sequence
Identical sequences gi|301613356|gb|XP_002936179|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]