SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301613360|gb|XP_002936181| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301613360|gb|XP_002936181|
Domain Number 1 Region: 543-647
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00019
Further Details:      
 
Domain Number 2 Region: 718-824
Classification Level Classification E-value
Superfamily SRCR-like 5.89e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00039
Further Details:      
 
Domain Number 3 Region: 52-158
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 4 Region: 332-437
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00028
Further Details:      
 
Domain Number 5 Region: 825-932
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 6 Region: 439-542
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00038
Further Details:      
 
Domain Number 7 Region: 161-265
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301613360|gb|XP_002936181|
Sequence length 961
Comment PREDICTED: deleted in malignant brain tumors 1 protein-like [Xenopus (Silurana) tropicalis]
Sequence
mpsraskqnreaeewssrsvqaawfgyprsgrvkrsemqeqkqslvssqgepeelrlsag
shkcegrvevkhhgewgtvcskrwdlsetdvvcrqlgcgvsgplgsrsaffgagsgkiwl
aglrctgeesalwdcrhpmwglrncghrddvgvrctgapeglrlvggenecegrvevkfq
gvwgtvtsdwdiaaasvvcrqlgctpspteitkavsfgpgtgkiwfnvisclgkeeslwn
cqiemrgipwfdhikdlgvicrgslafnhppeayksqkeneitrvsnsdfqtsrfledfp
nyydapefeddpdpvaasgisldpvsifndkleelklvggasrcegrvmvrfhgewgsmc
dyrwdmkeasvvcrqlgcnispgqhkaasfgpgsgklwlsqvkctgdeftlseckrnltm
fhncdhtadvgvicagggplelrlaggsnrcegrvevkhhgewgtvgdffwdkkaamvvc
rqlgcntsyeqatsfgagtgkiwfsglkctgnesalwdcepelnryriwnntadvgvica
gepeelrlvggtndcegrvevkhrgewgtvcgndwdtrdaavvcrqlgcnsslikattfg
ggsgkiwlshlqctgketslleckhgmwglhycnhgqdvgvicqgkrssmcpddeiyeei
easfmlpkdkeanlspgslakeknledgyddaavgllsshaskaerirgagsdtgtdenv
rliggdnecegrvevkhqgtwgtvcgrqwsakeasvvcrqlgcntsneyfstkatffgag
sgkiwlsnvkctgdepslawcmhntwgiekcdhtedvgvictgepeelrlvggnnecegr
vevkhrgvwgavcdhnwnqkaasvvcrqlecnnttegymkaqaasfgqssrnislsrvkc
tgeeavlwecqhqmwglsnclhradvgvickgegfskrvslhgmgyecvtlrfalrtstc
v
Download sequence
Identical sequences gi|301613360|gb|XP_002936181|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]