SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301613762|gb|XP_002936378| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301613762|gb|XP_002936378|
Domain Number 1 Region: 158-269
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-38
Family Link domain 0.0016
Further Details:      
 
Domain Number 2 Region: 272-358
Classification Level Classification E-value
Superfamily C-type lectin-like 8.36e-23
Family Link domain 0.0043
Further Details:      
 
Domain Number 3 Region: 1363-1431
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-21
Family C-type lectin domain 0.000073
Further Details:      
 
Domain Number 4 Region: 1319-1356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000572
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 5 Region: 47-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000553
Family V set domains (antibody variable domain-like) 0.023
Further Details:      
 
Domain Number 6 Region: 1283-1322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family EGF-type module 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301613762|gb|XP_002936378|
Sequence length 1434
Comment PREDICTED: hypothetical protein LOC779471 [Xenopus (Silurana) tropicalis]
Sequence
mdlqhpsrlitfgvwlfltgtvcidttgsedaaktlhihrhqrdmvrcslaqsvalpclf
llhpshppqqpndtsesprikwsrlqpgigqkevpvlvardnvvkvargyegrvslpgyp
hnrynatlvlssarvsdsgvyrceviygiddeqdtvplevtglvfhyraasnryaltfpe
avrscqensgviaspeqlqaafedgldncdagwlsdhsvrypiktprpgcygdrnnlpgv
rtygerdlqetydvycytegpqgdvyyvpekstlleasnsclrdggmlakvgqlysawrk
gmdqcdpgwladnsvrypirnprrncggeepgvrtlyqypnrtgfpnptrkfgaycfeal
qataptllgnkqqgpafmlqedrrlinpelqsqesgqtkesefnnvlpstdslisttthg
ffqmegsyprilgsskeiakeinvlppkqflqpsskeeqlqtvtrepmegdrllslrpea
ltfwgtqetetktqetgetksfsdplrdksrqpsasrvreedwslnvvdrelksrehtwr
dfleqpvadskeelpgidysvdeqalvneprpfpeddrnslhltwnlgdkdslfketdtf
neaatsaipetsepsiylskmslqnnitshqsslfkepdqsskirlpgdtgssnqnirgl
qekeenmnykeekgdtqihsvydkmqknnvdltteafqrsalhtsesqsvfneadgttgk
ktrlneqredkemnsrtlfathsdanddnnepgqqeftviyskyppttmdpmgngqleiy
yramlgenhmssvdvqdlpqavtvpgvdgnsfqsttssrlkntwrnpenmsknsfvdeka
qnggyggtekmivnntskteilptteniesfsgdskekdensllnqslpkpsvvtqisdd
fyfptvdhpnieaksiirdraikphengeqypsfqerqgkertfsaklastfkkimaqle
tkeviskelnvsdasitdsafrkqepgmlntvhppdndsyppeekvktaemttqylinmn
siqntesegwridkalskpsfpfttdmtmnsdnlqkltpttervelimatvnprnekava
ynlldhqtsvsalqlspdrgqnnseftnqtkpistqdsnntvaadeyiqelvdkthslst
aaentiklaqttsdsfprviternnleedafgtpisptivwsnttplesagwssilnnky
skqtsptavpsvdetdhhghvslspsqkedystldsllgylgnteapeieeasfhekdlg
sgldedsslwmiedhtstqgepqpcshnpclhmgtcqsngstyscichkgysgenceidi
declsnpcqnggtcideinsflclclssyggstcgkgfghentwiglndrtveqdfqwtd
ntalqyenwknqqpdnffsggedcvvmvsheegkwndvpcnynlpyickkgtge
Download sequence
Identical sequences gi|301613762|gb|XP_002936378|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]