SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301613801|gb|XP_002936388| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301613801|gb|XP_002936388|
Domain Number 1 Region: 1228-1368
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.03e-32
Family Synaptotagmin-like (S variant) 0.051
Further Details:      
 
Domain Number 2 Region: 2045-2177
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.4e-21
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 
Domain Number 3 Region: 1094-1153
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000269
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Weak hits

Sequence:  gi|301613801|gb|XP_002936388|
Domain Number - Region: 229-310
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0523
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301613801|gb|XP_002936388|
Sequence length 2217
Comment PREDICTED: protein unc-13 homolog C-like [Xenopus (Silurana) tropicalis]
Sequence
mvstllkslvfsyiyklckgmftkklgnptkkkessskkeqdisqfgltknpnisstiks
tvkkiakcssscnlsteeetikkefslsptfsyrvaianglqnnivvsgsnedglqeiss
ldssyseslsetrassnikeysshtmpvrrnrkslnslapsdgssdgertlhslkmgalr
klrkwkksqecvssdsevstwkkswglrsksldrtvrqqktntlepsfsstgcisqthdv
memifkelqgisqietelselrghvnslkqsideisssvevvqseieqlrtgfvqsrret
rdihdyikqigqqgntaglrflnvpeekqencesvvfkiliekmgfvdaqssmkielahr
igqqrecpnakprpilvyfgnpqhrdlvlkkcyklkgtgigvstdiltqdlkirkerllp
ssqtyesmdmkfsalepkinrneweshedsdkelesdinrnsyamiskseahiknsstkr
ssqtshnkrshktsadatytakqedgdlnfqspvsdnlekqgrgyyndmaplwhsqndfl
tpklsrsesdfsklcqsysedfsenqyfvrtngssllsssdrelwqrrqedgssnwyass
qeqafsneadpypeenelentetvdsgvsngvicvsgdrshysdsqlslhgdlspwkewh
qleqgtdsgldtstqhvfaynvncpsnqqiegyantyekcqstdhqyspenydysmdgns
pscpgndseaqnewpsefdaytetnandmyqnqtrlpmmyrsqselqsddsedappkswh
srlsidlsdktfsfpkfgstlqraksalevvwnkstqslsgydesgssfmgrfrtlsqst
anessttldsdvyaepyyykaddydveynqsaddnengadyvevmeqvlaklenrtntne
nleqvqeyqayeynsydtefeplqmdnyetqfvdtfdeevvvpeceiaydvtekddenqn
vpaekvvevpkkkrirpsfkeaamkaykkemadleerilagdskamdekariignsldas
klyeiqtyggpasglygidsmpdlrrkktipivrdvamtlaarkagisvamgirtfvnne
elkmhvfkktlqaliypissttphnfevwtattptycyecegllwgiarqgmrctecgvk
chekcqdllnadclqraaeksskhgaedktqniitamkermkirernrpevfqliqemfq
iskedfvqhtkaskqnvldgtskwsakinitvvcaqglqakdktgssdpyvtvqvgktkr
rtktifgnlnpvwdekfhfechnstdrikvrvwdedddiksrvkqhfkkesddflgqtfv
dvrtlsgemdvwynlekrtdksavsgairlkinveikgeenvppyhvqytclhenlfnhl
teiqnngivkipevkgdeawkvyfddaaqeivdefamrygiesiyqamthfsclsskymc
pgvpavmstllaninafyahttattnvsasdrfaatnfgrerfiklldqlhnslridlsk
yrdnfpatnperlqdlkstvdlltsitffrmkvlelqspprasavvkdcvracldstyky
vfvnchdlysqlldqgkkqdvpredqgptiknldfwpnlitlmvtiidedktsytpvlnq
fpqelnmgklsaevmwhlfaqdmkyameehekhrlckstdymnlhfkvkwfyneyvkels
afkdtvpeyslwfetfviqwldenedvsmeflhgalgrdkkdgfqatsehvlfscsvvdv
ftqlnqsfeiikklecpnpealshfmkrfantinkvllqyavivsndfssycgkenvpci
llnniqqlrvqlekmfenmggkeldldasamlkelqvklsgvldelsciygasfqvvied
cvkqmsvelnqmkgngnastnrnnaamdaeivlrplmdfldktlsvsakicektvlkrvl
kelwklvlnriekqivlppltdqtgaqmifsaakdlgqlsklkdhvireeakslslrqcs
imevvlatikqyfhaggnglkknflekspdlqslkyalslytqttdalikkyidtqtcqg
qstegsvgeisvqvdlfthpgngehkvtvkivalngllwqttamfrpfvevfalgpslsd
kkrkfgtktksntwspkynenfqfilsneesprayelhlcvkdycfaredrvigmtviql
knivdkgncaswyplmknicmdetgltilrilsqrsndevakefvklksdirspeei
Download sequence
Identical sequences XP_017947912.1.99540 gi|301613801|gb|XP_002936388|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]