SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301613828|gb|XP_002936412| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301613828|gb|XP_002936412|
Domain Number 1 Region: 293-580
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-43
Family Kelch motif 0.005
Further Details:      
 
Domain Number 2 Region: 714-854
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-25
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 3 Region: 60-182
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-21
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 4 Region: 995-1041
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000711
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  gi|301613828|gb|XP_002936412|
Domain Number - Region: 910-945
Classification Level Classification E-value
Superfamily Plexin repeat 0.000785
Family Plexin repeat 0.0029
Further Details:      
 
Domain Number - Region: 30-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00854
Family EGF-type module 0.079
Further Details:      
 
Domain Number - Region: 632-664
Classification Level Classification E-value
Superfamily Plexin repeat 0.0575
Family Plexin repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301613828|gb|XP_002936412|
Sequence length 1321
Comment PREDICTED: attractin-like [Xenopus (Silurana) tropicalis]
Sequence
mpghsrggerrwlvavlllmagtrisgtagkecekpcvngmcqpstgqcacdpgwtgeqc
qhcggrfmltgpsgfvtdgpgnykyktkctwliegsentvlrlrfnhfatecswdhlyvy
dgdsiyaplvaafsglivpeqesnnsvpevaitsgyallhffsdaaynltgfnisynvda
cpnncsgrgdctqnpdgnvycdcaehwkgeacdipycldncgfpthgicdfnntkscicr
dgwqgpscdvsipanesfwvreenlhpklarashravvvddvmwivggymfnhsdyqmvm
aydlpshkwlslnnsvnsvvvryghslapykdklymyggkidatgnvtnqlyvfhihnqs
wvqilpkakdqyavvghsahivtlkdgsvvmlvffghcplygyissiqqysldtnlweiv
qthgalvqggyghssvydeksrsiyihggykaftankyrladdlyrysvdnqtwmilkds
qsfrylhtaviisgtmlvfggnthndtsmshgakcfssdfmaydfacdywsvlphpmfqy
dvsvdrfghsavlrngtmyvfggfnslllsdvltftprscetyksenacmvaepgircvw
naslslcsswenatpeqeeliscpnktiadnekcdqytdcfsctvnshgcqwcndhcisl
nsnctvlqgaisvyeqcpknnpgfycnkktsckscamdqncqwepknqeciglpenicga
nwhlvgsscfritsakdnydnaklacrnqnaylasltsqkevefvikhlqrlqpktdltp
wvglrkinvsywcwedmspfsnttlqwqqgepsdagfcgylaepsvgglkaatcihqing
svcerpanysakqcrtpcasrgscgectsgssecmwcsnmkqcvdsnayvasfpfgqcme
wytmstcppencsgyrtcaqclehpgcgwctdpsntgkgqcmegshrgpmkmpnsshvtn
ttpvlnvsmcpaeqyynesfimcpphcvsslsvacqcnghskcvnesicekcenlttgkn
cescisgfygdptnggscqpckcnghasmcntntgkcfcttkgvkgeecqlcevenryqg
nplkgtcyysllidyqftfslsqeddryytainfvatpeeqnrdldmfinasknfnlnit
watsftagtqageeipiisktnikeykdsfsnekfdfhnnpnitffvyvsnftwpikiqv
afyrhthrialpamyscflslllvaavvwkikqscwasrrretvpkpialepccgnkaav
lsifvrlprglggipppgqsglavasalvdisqqmplaykeksgaarnrkhqppaqpgtc
i
Download sequence
Identical sequences gi|301613828|gb|XP_002936412|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]