SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301613879|gb|XP_002936430| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301613879|gb|XP_002936430|
Domain Number 1 Region: 35-155
Classification Level Classification E-value
Superfamily TIMP-like 1.49e-53
Family The laminin-binding domain of agrin 0.000000611
Further Details:      
 
Domain Number 2 Region: 1354-1560
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.13e-41
Family Laminin G-like module 0.00041
Further Details:      
 
Domain Number 3 Region: 1837-2041
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-34
Family Laminin G-like module 0.000000241
Further Details:      
 
Domain Number 4 Region: 1611-1825
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-32
Family Laminin G-like module 0.00096
Further Details:      
 
Domain Number 5 Region: 473-539
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 2.5e-16
Family Ovomucoid domain III-like 0.0088
Further Details:      
 
Domain Number 6 Region: 552-607
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000707
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 7 Region: 176-246
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000416
Family Ovomucoid domain III-like 0.0059
Further Details:      
 
Domain Number 8 Region: 1109-1199
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000235
Family SEA domain 0.0037
Further Details:      
 
Domain Number 9 Region: 417-466
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000818
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 10 Region: 870-939
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000111
Family Ovomucoid domain III-like 0.0053
Further Details:      
 
Domain Number 11 Region: 346-394
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000018
Family Ovomucoid domain III-like 0.0078
Further Details:      
 
Domain Number 12 Region: 252-322
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000222
Family Ovomucoid domain III-like 0.007
Further Details:      
 
Domain Number 13 Region: 707-758
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000319
Family Ovomucoid domain III-like 0.0056
Further Details:      
 
Domain Number 14 Region: 625-672
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000402
Family Ovomucoid domain III-like 0.0034
Further Details:      
 
Domain Number 15 Region: 762-805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 16 Region: 1553-1588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000046
Family EGF-type module 0.013
Further Details:      
 
Domain Number 17 Region: 816-853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family Laminin-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301613879|gb|XP_002936430|
Sequence length 2046
Comment PREDICTED: LOW QUALITY PROTEIN: agrin-like [Xenopus (Silurana) tropicalis]
Sequence
mgrrwgapavllwtlwalaavglgfsrgpcperelelreeeanvvltgtveeimnvdpvh
htysckvrvwrylkgreivtndilldggnkvmvggfgdpticdnqvstgdtriffvnpap
rsmwpthrnelmlnsslmritlrnleevemcvegkstalifgfpihtspvvppdmcrgml
cgfgavceksstdpsqatcickktacasivapvcgsdystysneceleraqcnqqrrikv
iskgpcgtkdpcstvscsygstcvrstdgqtakcicpatctgvpenvvcgsdgkdyhnec
qlnkqacdnqenlykkfdgrcdpcriamnnqnkacrvnprtrqlemqyrpeycpvrrdpv
caddgvtydndcvmtrsgfirgielqkvhsgqcqpqdkckedckhnsvclnrrgvtrcsc
drvtcdstykpvcggdsrtyandcerqkaecfqkatipvkhkgpcdlhspspclnttcsf
gaacvvknkkavcecqqvcqavydpvcgsdkrtygnpcelqstactlkkeitilhkgpcg
kkqxtithfgaiceaetgrcvcptecvpsaqpvcgtdgntyesecelhvractqqinlqv
aaqgdcktcgntlctfgakcvnnqcvcltcerqpylpvcgsngvtydnqcelkaasckqm
klievsragscedecgsgtdgsgsgedseceqdrcrryggswdedaeddrcvcdftchav
lrilvcgsdgitysnecelkktrcekrqdlyvagqgacrgscqchqygsyggtcdpttgq
csckpgvgglkcdrcepgfwnfrgivtdkksgctpcncdpvgavrddceqmtglcscktg
isglkcsqcpdgrkpgltgcekdpsapkscdaikcqfgatcvviggfahcecpsplcaea
nltkvcgsddvtygdwcqlktiacrqgrtitvkhtgpcqetvthanlqtlsptgtpsppi
vrtlptpgttkitktkkktdsfqlvleatslspfssttmrpvtqthrahtstvrpaitip
tvhptvlqiydesgsgsgdeeleasgdqdlsgvepkepfdveneqkeeaeekrdfvattv
ierascyntplgccsdgktpandaegtncpktkifqgvliieelegqevfytpemsdyks
elfgetarsienaldnllrnsdikrdfksirvrdlgpsnsiraiveahfdpattmsamdv
qrallrqlksskkraitikkpiqenvkfldfdwvplmvttttttaattsmvattavaptt
ttpvvattttvartplprrivavkttpvtitqqpvttprmttrrpvttkrpmttipattr
rkppriqavtkkpprpceshpclhggtcedngkdftcscpagrggavceksikyfipgfg
gksylafkmmkayhtvriamefrsseqnglllyngqslgkdfislavnngfvelrfntgs
gtgiitskvpiepgkwhqlvvnrnrrsgmlsvdgeshvngespsgtdglnldtdlfigga
pedqmavvsertslsvglkgcirqldvnnqlynlqeggadvlygsgvgecgnnpcqpnpc
hngaacqvkeaemfhcqclsgytgptcadernpcdpnpchvsatclvlpeggakcecpmg
regefcekvsnqdlnlpflpqfngysylemkglqtfatdlqdklamevvflasnpnglif
yngqktdgkgdfvslslhdgnleyrydlgkgaavikskekiplntwlsvslersgrkglm
rinnmeqvtgespaphtalnlkeplfvggapdfsklaraaaastsfegaiqkisikglpv
lreenirsaieistfrshpctkkpfpcqngglcspnkgnyecvcqrgfsgsqcekvtiek
aageseavsfdgktyleyhiavtksekallvnqfelsikteatqglilwsgkgterayyi
alavvggyvemtydlgskpvvlrstvpvntnewihikavrdnrdgilrvgnedpvhgssp
fgvkeldtdgalwlggieklsasyklpkaystgfigcmkdvlvdqqdlhlvedalnkppi
lycsak
Download sequence
Identical sequences gi|301613879|gb|XP_002936430|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]