SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301614097|gb|XP_002936534| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301614097|gb|XP_002936534|
Domain Number 1 Region: 438-688
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.34e-77
Family Eukaryotic proteases 0.00025
Further Details:      
 
Domain Number 2 Region: 905-1102
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.93e-50
Family Eukaryotic proteases 0.0028
Further Details:      
 
Domain Number 3 Region: 765-905
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.51e-34
Family Eukaryotic proteases 0.0071
Further Details:      
 
Domain Number 4 Region: 344-407
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000196
Family Hepsin, N-terminal domain 0.029
Further Details:      
 
Domain Number 5 Region: 315-346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000445
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 6 Region: 137-172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0039
Further Details:      
 
Domain Number 7 Region: 177-216
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000327
Family LDL receptor-like module 0.0045
Further Details:      
 
Domain Number 8 Region: 272-302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000419
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 9 Region: 229-260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000759
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 10 Region: 89-129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000772
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301614097|gb|XP_002936534|
Sequence length 1161
Comment PREDICTED: hypothetical protein LOC100494550 [Xenopus (Silurana) tropicalis]
Sequence
mscssfqhqvpqlsaipchsaspphssnvpraagvaapptqspppsntltgplprveitr
lrirketkicigvaisiilvaagssaltwyivthpscqnlcsyssncfypnqicdgiadc
pygddekncetsiqtnptcqmycsytytcihayqicngvqdclygdderncdteivtwpp
cimfcsygpntkrcivayeicdgirhcpdgddelnssrqaillspptcqvycsfsfscis
ssqicdgvgdclfgddeencgpqmlptfptcqfcsfssnciranqicngiadcpygddee
ncgpiifpslpscpmycistfmcisakqicngiadcpygddeencvrlygadsqlqvyst
lksawlpvcadnwtdaygrlacqdigyngssynrsdtmnstyapngyfqlkngsqtskly
ssiehrsvmnflpkpngtdllligcgvsynsvashkvggtkaasgnwpwhvglryktgll
cggsiispkwivtaahcvygsysnasgwkvfagaltqpsysdangysveriivfpgynss
dndndialmkltndikfsyttqpvclpnvgmfweagtqcwisgwnttsqggnisttlqya
evqlvpshvcnqshvyngsitpsmlcadarhgrigscqgdgggplvtetngtwwlvgets
wgvgcaqpnkpgvygnmtsflgwiylqmrsvippnknnyeypapppyeslplavpmrpvp
ppppyspeeptgqsgaapptstsswsrrhlifpslptcqmfcsdsficinanqicdgvpd
cpygddeencgcgvsynsaaslieaganaasgnwpwqvgllyktgllcggsiispkwivt
aahcvygsrsnasewkvfagaltlpsysdangysveriivfpgynssdndndialmkltn
eitfsccgvsynsaaslieaganaasgnwpwqvgllyktgllcggsiispkwivtaahcv
ygsrsnasewkvfagaltlpsysdangysveriivfpgynssdndndialmkltneitfs
ytpsrcaypmpecsgrpahnagylvgvpplkegdsggplvtktngtwwlvgdtswgigca
rpnkpgvygnmtifvewiylqmkyltqlnkntnrqpavpangsgrytikgrlppkpytir
eyidqldlvplrslppeirsk
Download sequence
Identical sequences gi|301614097|gb|XP_002936534|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]