SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301614264|gb|XP_002936615| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301614264|gb|XP_002936615|
Domain Number 1 Region: 911-978
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-18
Family TB module/8-cys domain 0.00066
Further Details:      
 
Domain Number 2 Region: 2252-2324
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.96e-18
Family TB module/8-cys domain 0.00037
Further Details:      
 
Domain Number 3 Region: 2014-2083
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.88e-18
Family TB module/8-cys domain 0.0000312
Further Details:      
 
Domain Number 4 Region: 412-539
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.33e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 496-617
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-17
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 6 Region: 1809-1935
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-17
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 7 Region: 2311-2456
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-17
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 8 Region: 1487-1560
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.16e-17
Family TB module/8-cys domain 0.0000187
Further Details:      
 
Domain Number 9 Region: 1904-2023
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-16
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 10 Region: 147-232
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.14e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 11 Region: 1277-1412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 12 Region: 1159-1283
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000235
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 13 Region: 1646-1712
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000785
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 14 Region: 293-359
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000017
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 15 Region: 612-681
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000628
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 16 Region: 807-891
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000746
Family TB module/8-cys domain 0.0021
Further Details:      
 
Domain Number 17 Region: 2126-2181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000385
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 18 Region: 2495-2608
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000667
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 19 Region: 187-304
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000013
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 20 Region: 726-776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000182
Family EGF-type module 0.006
Further Details:      
 
Domain Number 21 Region: 1071-1159
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000361
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 22 Region: 1566-1614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000453
Family EGF-type module 0.00058
Further Details:      
 
Domain Number 23 Region: 1694-1811
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000141
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 24 Region: 686-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000271
Family EGF-type module 0.01
Further Details:      
 
Domain Number 25 Region: 1443-1490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000567
Family EGF-type module 0.00041
Further Details:      
 
Domain Number 26 Region: 2443-2493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000789
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 27 Region: 1406-1454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000469
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 28 Region: 990-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000963
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 29 Region: 2206-2254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000141
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 30 Region: 770-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000635
Family EGF-type module 0.012
Further Details:      
 
Domain Number 31 Region: 2085-2122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000913
Family EGF-type module 0.0011
Further Details:      
 
Domain Number 32 Region: 1608-1651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000595
Family EGF-type module 0.0065
Further Details:      
 
Weak hits

Sequence:  gi|301614264|gb|XP_002936615|
Domain Number - Region: 1035-1066
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000323
Family EGF-type module 0.0012
Further Details:      
 
Domain Number - Region: 118-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00172
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 84-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.032
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301614264|gb|XP_002936615|
Sequence length 2789
Comment PREDICTED: fibrillin-1-like [Xenopus (Silurana) tropicalis]
Sequence
mshmqpcnneafsqinvqvfsfrpnvcgsrynayccpgwktlpggnqcivpicrhscgdg
fcsrpnmctcptgqiapscgsksiqqcnircmnggtcsdeqchcqkgyagahcghpvceq
gclnggrcvapnrcactygftgpqcerdyrtgpcftvvsnqmcqgqlsgivctktlccat
vgrawghpcemcpaqphpcrrgfipnirtgacqdvdecqaipgmcqggtcintvgsfeck
caaghrfnditqkcedidecsiipgicesgecantvgsyfckcppgfytsadgsrcvdir
pgycftslangrcinqqpqtvtktqcccdsgrcwspgpttppdmcpirgtdeyrklcivp
gvppigpeypplgpidgirpfqpiypppvypgyptrgpsvvvgvnvsqqqqitdycalfr
nlclhgrciptpgsyrcecnkgftldgrgecidvdecennpclhadcvntpgsyickcyp
gfqststrtecrdideclqngricnngrcvntdgsfhcvcnagfqvsadgkncedmdecs
vrnmclngmcinedgsfkcickpgfqlapngrfctdidecetagicmnghcvntegsfrc
ecfpglavgldgrvcvdthmrstcyggykrgqcvrpllgavtksecccastdfafgepcq
pcpakmseeyqalcssgpgmtsvgtdinecaldseicpngicenlrgtykcicnagydva
itgkscvdidecalntllcdngqcrntpgsfsctcpsgfvykpdlktcedidecesnpci
ngvcrnipgsfvcecptgstldktkticietikgtcwqnivngrceininggtlrsqccs
tlgaawgspcmpceadpvcakgfarsrgttcedvnecdvfpglctngqcvntmgsfvcqc
psgmtldaskrtcldirleicylkhedeecsaqiagrhrmdacccsvgaawgpdcdecpe
kgttefetlcprgpgfaskeiapgktfskdinecrmipslckygkckntigsfkcrcdng
faldaeernctdidecrispdvcgqgncvntpgdfecdcfegyesgfmmmkncmdidece
rnpllcrggiclntegsfkcecppghevapdnsacidinecelstdlcrhgrcinligry
qcacepgyqltpdklscvdtnecdffnggcdtfctnsegsyechcrdgfalmpdhrsctd
idecetnpnicdggqctnipgeyrclcfegymasddmktcldvdecelhlniclsgscen
tkgsfichcdpgysgkkgqtgctdineceigahncdrhatctntpgsfkcscspgwvgng
ikcsdldecsngthlcspnadckntmgsyrclckegyvgdgftctdvdecsenlnlcgng
qclntpggyrcdcdmgflpsvdgkacedidectlpnicvfgtcrnlpglfrcdcdtgyel
drtggnctdvdecseptmcisgtcqntpgsytcecppdfelnptrvgcvdtrsgtcyldv
kprgdngdvscsneigvsvpkascccslgkawgtpcelcpavnsseykvlcpggegfrpn
pitviledideclelpglcqggkcintfgsfqcrcppgyylneetrvcddvnecdqpgic
gpgtcfntvgnytcicppdymqvnggnncmdmrrslcfrnyyaenqtcdgellynmtkkm
cccsynigrawhrpceecplpstdefaslcgsarpgflidiytglpvdidecreipgvce
ngvcinmvgsfrcecpmgffyndkllicedidecqngpvcqrnadcvntpgsyrcdckpg
ykftstgqcvdrnecqeipnicshgectdttggyycvchngfktnedqtmcldinecerd
pcgngtckntigsyncrcfdgfilshnndcididecttlngqlcrngqcnntvgsfvclc
negyekasdertcldinecaldpgkcapgtcqnldgayrcicppgyvlegdtckdidecv
eepeicalgtcsnvpgsftclcpegfvlsstgkrcqdlrvsfcftkfedgqctspkarnh
skqecccalngagwgtpcelcpvdgdaalqqicpfgmgvivgpddervdmdecidpdkck
ngqcintdgsyrcecsfgyvlsvdecidvnecaqnpllcafrcvntygsyeckcpagyvl
redkrmckdqdecedgthdceskqmtcknligtymcicgpgyqrrldgegcmdlneclkp
gicdngkcvntmgsykcdclegfnasatetecidnrlgycftevlhtmcqigssnrnsvt
ksecccnsgrgwginceicpfqgtvqfkklcpygkgfttggedidecqvlhgicrngqcv
nergtyrcecnpgytpditgtscidldecsqspkpcnfickntdgsfqcscprgyilqed
grsckdldecatkqhncqficvntiggftckcppgftqhhtacidnnecasdvslcgakg
icqntpgsyscdcqrgftldqsgaacedvdecdgshrcqhgcqnivggyrcscpqgylqh
yqwnqcvdeneclnahacggaschntlgsfkcmcptgfqfeqfagacqdvnecsssqapc
sfgcsnteggyvcgcppgyfrigqghcvtggglsraqdmavsgeiddnslspeacydcki
ngypkrgrkrrstnetalngeeeqleppvsleswdiekplilsfnvshlnnkerileltp
alntltnhnrylidsgnedglfrinqkdgisylhltkkkpapgsysieinsvplykekel
fqledkhdrdylsgelgdilkmkitillh
Download sequence
Identical sequences gi|301614264|gb|XP_002936615|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]