SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301614423|gb|XP_002936681| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301614423|gb|XP_002936681|
Domain Number 1 Region: 125-404
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.1e-76
Family Nuclear receptor ligand-binding domain 0.00000000189
Further Details:      
 
Domain Number 2 Region: 72-151
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.39e-27
Family Nuclear receptor 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301614423|gb|XP_002936681|
Sequence length 442
Comment PREDICTED: retinoic acid receptor gamma-A-like isoform 3 [Xenopus (Silurana) tropicalis]
Sequence
MYDCMEAFPLMPRPLYDMSPQGPCMLRKAGCFGGLDPFGWMQSHSMQSVETQSTSSEEMV
PSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCQI
NKVTRNRCQFCRLQKCFQVGMSKEAVRNDRNKKKKEIKEEVVVPDSYEMPPEMEELIQKV
SKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELSTKCIIKIVEFAKRLPGFTT
LTIADQITLLKSACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFA
FADQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVEKLQEPLLEALKFYARRRRPDKP
YMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEAFEDGAETPKPSE
RPSSESSDGSPTEEDSSGSKTP
Download sequence
Identical sequences F6VXM9
XP_002936681.1.99540 gi|301614423|gb|XP_002936681| ENSXETP00000027722 ENSXETP00000027722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]