SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301614804|gb|XP_002936872| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301614804|gb|XP_002936872|
Domain Number 1 Region: 96-225
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000135
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 223-346
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000107
Family Growth factor receptor domain 0.023
Further Details:      
 
Weak hits

Sequence:  gi|301614804|gb|XP_002936872|
Domain Number - Region: 38-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00144
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301614804|gb|XP_002936872|
Sequence length 460
Comment PREDICTED: EGF-containing fibulin-like extracellular matrix protein 1-like [Xenopus (Silurana) tropicalis]
Sequence
MLKILLITTLVHFTCAQDTEETITYTQCTDGYEWDPMRQQCKDIDECEIVHDACKGGMKC
VNHFGGYLCLPRTAQILVNNGQDDSPNTPQEPAGSQQINGQNTAVEVHNPPNVQQVVPNA
PQRIQCAPGYEPTAQNMCQDIDECAAGTHNCRSDQVCSNLRGSFSCQCPRGLQRRGDQCI
DIDECALSSYCHHLCVNTFGSYYCQCNPGFQLSANNYSCTDIDECASSPCAQECYNMVGS
YFCQCNAGYELSRDRVNCEDIDECRTSSYLCQYQCVNEPGRFSCICPEGYQLAGTRTCQD
INECDTDAHDCGEDTMCWNYYGAYRCYPRNPCQEPYVRMSENRCVCPVANPICRDQPYSI
LYKYMSIHSNRPVPADIFQIQATMIYSNTINTFRIKSGNENQDFYLRHTSGISAMLVMVK
PLTGPREYIVDLEMVTVNSLMNYRSSSILRLTIVVGPYSF
Download sequence
Identical sequences F7DNU2
XP_002936872.1.99540 gi|301614804|gb|XP_002936872| ENSXETP00000013387 ENSXETP00000013387 8364.ENSXETP00000013387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]