SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301615189|gb|XP_002937043| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301615189|gb|XP_002937043|
Domain Number 1 Region: 467-599
Classification Level Classification E-value
Superfamily TIMP-like 7.53e-35
Family Netrin-like domain (NTR/C345C module) 0.013
Further Details:      
 
Domain Number 2 Region: 283-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000356
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 339-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 4 Region: 402-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 94-173
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000255
Family APC10-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301615189|gb|XP_002937043|
Sequence length 602
Comment PREDICTED: netrin-1-like [Xenopus (Silurana) tropicalis]
Sequence
mlrcplvlvllslsctaqegrggygmnmfsiqtsqpdpcydengnprrcipdfvnsafgk
evrvsgtcgkppsrycvvtekgedrfrnchicntsdpkrahppsfltdlnnphnltcwqs
enyiqypqnvtltlslgkkfevtyvslqfcsprpesmaifksmdygkswvpfqfystqcr
kmynkpnkaiitkqneqeaictdshtdmhplsggliafstldgrptahdfdnspvlqdwv
tatdikvvfsrlhtfgdeneddselardsyfyavsdlqvggrckcnghasrcvkdrddnl
vcdckhntagpecdrckpfhydrpwqratareanecvacncnlharrcrfnmelfklsgr
rsggvclncrhntagrhchyckegyyrdmtkpithrkackacdchpvgaagktcnqttgq
cpckdgvtgitcnrcakgyqqsrspiapcikipvvppttaassmeepadcdayckaskgk
lkinmkkyckkdyanqqrfmkanragdwwkftvnvisvykqgtnrirrgdqnlwirakdi
ackcpklkptkkylllgndedspdqngvvadksslviqwrdtwarrlrkfqqrekkgkck
ka
Download sequence
Identical sequences gi|301615189|gb|XP_002937043|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]