SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301615499|gb|XP_002937209| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301615499|gb|XP_002937209|
Domain Number 1 Region: 103-174,202-401
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.77e-45
Family Nuclear receptor ligand-binding domain 0.0000977
Further Details:      
 
Domain Number 2 Region: 32-118
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-28
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301615499|gb|XP_002937209|
Sequence length 405
Comment PREDICTED: LOW QUALITY PROTEIN: nuclear receptor subfamily 2 group E member 1-like [Xenopus (Silurana) tropicalis]
Sequence
malqksallgwirkvelvseeakpagggrildipckvcgdrssgkhygvyacdgcsgffk
rsirrnrsyvcksgnqggclvdkthrnqcracrlkkclevnmnkdavqhergprtstirk
qvalyfrghkeingstphfpsaalpaptffttvsqlephnleltaisttperqtlvglaq
ptpkvslnystaghytyfltfcqafissiatarxweyawlmclxtyhsyivwqlmlleda
wrelfvlgiaqwaipvdastllavsgmnsdntesqklnkiiseiqalqevvsrfrqlrld
atefaclkcivtfkagvpphsgselrsfrnaaaiaalqdeaqltlnsyihtryptqpcrf
gklllllpalrsinpstieevffkktignvpitrllsdmykssdi
Download sequence
Identical sequences gi|301615499|gb|XP_002937209|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]