SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301615641|gb|XP_002937280| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301615641|gb|XP_002937280|
Domain Number 1 Region: 550-747
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-30
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 2 Region: 1011-1205
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-21
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 3 Region: 752-775,830-964
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.52e-18
Family Laminin G-like module 0.026
Further Details:      
 
Domain Number 4 Region: 128-249
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000706
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 347-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000655
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 6 Region: 1379-1416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000804
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 7 Region: 1226-1267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000127
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 8 Region: 441-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000162
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 9 Region: 1297-1338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000526
Family EGF-type module 0.014
Further Details:      
 
Domain Number 10 Region: 1263-1305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.006
Further Details:      
 
Domain Number 11 Region: 479-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000155
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 12 Region: 29-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000214
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 13 Region: 386-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000042
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 1343-1383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000118
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  gi|301615641|gb|XP_002937280|
Domain Number - Region: 1028-1058
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000373
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 985-1024
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0123
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 103-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0132
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301615641|gb|XP_002937280|
Sequence length 1490
Comment PREDICTED: LOW QUALITY PROTEIN: crumbs homolog 1-like [Xenopus (Silurana) tropicalis]
Sequence
mvahtqpkpsleyraslhttniqlkrlaqtcvsspclnggtcqetasgftclcpaeplaf
tgttcgdlydacaidrcpsthscqstpghphfqcvcqpglnctnecqrnscpfqnfqctv
gedsfmckcqsgyggvdcnfevspcfqnpcqnnatclaegdsfrcvcepgftgqecevnv
necasnpcqnealcvdkvdrymcfcvpgfqghhceidinecasrpcqnngtcmnqldqye
cacangytgknarntinflvvsplilvcnissgtwahlsaqlfhtipppsgclgrtxkyv
xctvppspcqxgqsvcsecrliwavyfrfrcdcsntgfvggrceveilecdsnpcqnngt
cmervngyeclcwkgysgihceiddnecfeepcvngglclelsnqsyygtepefnkfsys
qaagylcrcqqgftgpncsvnideceswpclnggtctdlingflcncasgytgfdcsini
deckdspckngascedgvadyscicppaaqdgtvwggkncsvmligclehscqnaaecip
lytgqshsytckcqpgfvgnncstpttfsflsqgylmydsplsnesyqsnmsvrfrttlp
dmvlmyrgdedsflaleiyngflhmrlkgngrlfplviddykvndghwhnvevdllsnsf
lkislfhndcrnglcsqkqtptegfdpylpesfrslyiggliqeslikntlsqqnftgcl
edlvvdlvtqlphnvssdrsfgmvlgckkaevchpnpchngancidlwssftcecirpfk
gstcmqgkysgavisvsrfdvvfelfaeyiagtffregipshsyfelnqdfgtsfnisaf
irtlksnglllqisygttpyfrtylnnswihietlsaqplvfkknvsdgmkhfisisvre
gnvtvtdlqqevylgmlppviitkgdavhvgglatadstifwggyfkgcvqdlrinndhl
effhpehinvqetlyfgnntnvtencisddvchqgpcrnegncsvtwndfvcscpanftg
krceepvwcrrspclpgstcvdvpkgfvclanvsfqghssavftpiiseehnltsislaf
rtrdrdavllqssknvdsvlieiqggylfvdlqsgnnvdgvqlngtidvadaiwhrvvit
meratkvnshwtfqlddsvqkkfqwegdnlnfmrnnisivlaegytgclgdvsiggiylp
ftdhvlpqqdqfirksdalelgcrgadvcsespclhggtcqdlfnsfsctcrigwnghrc
einiddcksspclhgfcidleadyqcsceagytsrnceinindcqhhqclnggtcvdgvn
nytckcpanyagtfcqwpfppeqcnknitcfnggrcnsgiwganctcrpgfsgrrceinv
ndcesnpclnggtcqdsvntfkcicnssfsgvrceksdaasmfpfplvgvavpvtcgvll
llvigvifmvltarkrrqsegtyspsqqevagarlemdsvlkvppeerli
Download sequence
Identical sequences gi|301615641|gb|XP_002937280|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]