SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301615705|gb|XP_002937307| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301615705|gb|XP_002937307|
Domain Number 1 Region: 70-127
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.7e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301615705|gb|XP_002937307|
Sequence length 128
Comment PREDICTED: helix-loop-helix protein 1 [Xenopus (Silurana) tropicalis]
Sequence
MLNSEQTEIPAHSETESVFSDCGGGGGLTDASGISFCGETRICEASDTVKRELQHLSREE
RRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYIS
YLNHVLDV
Download sequence
Identical sequences XP_002937307.1.99540 gi|301615705|gb|XP_002937307| 8364.ENSXETP00000012850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]