SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301615896|gb|XP_002937402| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301615896|gb|XP_002937402|
Domain Number 1 Region: 1295-1560
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-50
Family YWTD domain 0.00000183
Further Details:      
 
Domain Number 2 Region: 562-828
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-47
Family YWTD domain 0.00000684
Further Details:      
 
Domain Number 3 Region: 1839-2084
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-45
Family YWTD domain 0.0000218
Further Details:      
 
Domain Number 4 Region: 240-503
Classification Level Classification E-value
Superfamily YWTD domain 1.01e-42
Family YWTD domain 0.0000802
Further Details:      
 
Domain Number 5 Region: 2147-2416
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-32
Family YWTD domain 0.0000835
Further Details:      
 
Domain Number 6 Region: 1606-1791
Classification Level Classification E-value
Superfamily YWTD domain 8.37e-30
Family YWTD domain 0.00016
Further Details:      
 
Domain Number 7 Region: 2886-2966,3165-3220
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.49e-22
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 8 Region: 2974-3172
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-20
Family YWTD domain 0.00025
Further Details:      
 
Domain Number 9 Region: 138-230,505-553
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 10 Region: 1198-1287,1553-1608
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000008
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 11 Region: 912-957
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000942
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 12 Region: 1040-1075
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00025
Further Details:      
 
Domain Number 13 Region: 956-995
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 14 Region: 2639-2675
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 15 Region: 2849-2890
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 16 Region: 2718-2754
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 17 Region: 1087-1123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 18 Region: 877-911
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 19 Region: 2761-2795
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 20 Region: 1001-1038
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 21 Region: 2545-2584
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 22 Region: 1793-1843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000115
Family EGF-type module 0.012
Further Details:      
 
Domain Number 23 Region: 2678-2720
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000127
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 2504-2545
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 25 Region: 66-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 26 Region: 2598-2634
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000615
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 27 Region: 2798-2838
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 28 Region: 2469-2506
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 1169-1205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 30 Region: 1134-1166
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000432
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 31 Region: 110-145
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000694
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 32 Region: 2103-2152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000017
Family EGF-type module 0.014
Further Details:      
 
Domain Number 33 Region: 833-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000964
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301615896|gb|XP_002937402|
Sequence length 3233
Comment PREDICTED: low-density lipoprotein receptor-related protein 1B-like [Xenopus (Silurana) tropicalis]
Sequence
maqgenssnfpplqfpagraedktfkngfpltfmvqssllcrcafndgfrsvspyvcsfa
aaeqqlcdpgeylchdnvtcvsqswlcdgepdcpdnsdesvdtchekivfkcprnhvact
gtkncihysklcngvydctdgydegahcrelqttcqkrncqykcaimrngtecycrdgye
tgpdgrtckdidecaaygscsqtcrntlgsytcsciegyliqsdnksckaknepadrppv
lliansetievldinggkaptrssmnangihtlgfiydenkvcwietkkptnqlkcykit
ktgtftderiiqlsqflnnvhqmavdwltgnyyfvddgndrifvcnhngtvcitlidldl
hnpkaiavdatagklfftdygtvakvercdldgmnrtrivvskieqptaltldlvnkfvy
wadvyldyievvdyegrnrqsiiqgkevshvyglslfenylyasntdsstivrinrfnst
dvhsllslenvrdihiyhkrtqpavrsyacemnpdgmpggcdhicllgssfkmrtcrckt
gfslasdgrsckkpknelfliygkgrpgiiramdlnskvsdeymlpienlvnpraldyha
etnyiyfadttsfligrqkidgsgretilkddldnvegiavdwisnnlywtndghrktin
varlekasqsrktllegemshprgivmdpvngwmywtdweedeiddsvgriekawmdgse
rqifvtsnmlwpnglsldhensilywcdafydhieqiylngtlrkvvgsgkelnhpfgls
hhghslfwtdymngsifqldlrnknitllrqerpplfglqiydpkkqqgdnacrlnnggc
gtlclaipggrvcgcadnqhldennstcvfnveeklpqlcnseefqcknyrciqeswkcd
geddcldgsdedfenclnhscpndqfkcrsnrcipkrwlcdgandcgsnedesnetclar
tcqphqyscnngrcislswicdqeddcgdrsdemascefktcepdtqfvcgngrcisnkw
hcdsdddcgdgsdesgcslsctdkqfrcssgrcipahwvcdgdndcgdfsdethancsrt
vspvsgaceakqfqchpdgncipelwlcdgekdcedgsdergcngtlrqcdaktkfackn
tgrcisnawvcdgdidcedhsdedycegyicgppkypcandtsiclqpeklcngrrdcpd
gsdegdicdecslnnggcshqciiapgrgivcscpqgmhlgtdnktceqvdyctkhtkcs
qvceqhkqvvkcscyegwvlntdgetcssvdtfeafiifsirheirridlhrrdysllvp
glrntialdfhfnqsllywtdvvedkiyrgklsetsgvsgievviqhglatpeglaidwi
agniywidsnldqievakldgkmrstliaggmehpraialdprygilfwtdwdatfprie
sasmsgagrkiiykdmesgawpngltvdhferrilwtdarsdaiysalydgtamkeiirg
heylshpfavslygsdvywtdwrtntlskankwtghnvsviqktsaqpfdieiyhpsrqp
qapnpcasengkgpcshlclinfnrtaacacphlmklssdkktcydihsirglavdwlsr
nlywisseydetqinvarmdgslktsvihgidkaqslavhpirgkifwmdgnsinmanmd
gsnskilfqnqkepiglsidygdnklywissgnatinrcsldgsnleviesmkselskpt
altivdnklwwadqnlgqigtcnkrdgrnpsvmrnktlgvmhmklydkeaqqgsnpcqin
nggcsqlclptsettrtcmctvgynlkknrmscqgiesflmysvhegirgipldpsdrmd
almpisgtsfavgidfhagndsiywtdmglnrisrsrrdqtwkedimtnglgrvegiaid
wiagniywadhgfnvievarlngsfrfvvlsrgidqpraiavhpekgylfwtewgqtpci
srarldgsertvlvntaiswpngisvdyeenklywcdartdkieridlesgrnreivlsg
snvdmfsvvvfgayiywsdrahsngsirrahkndatdavtmrtglginlkdvkvfnrare
kgtnicaknnggcqqlclyrgnmqrtcacahgylakngvtclkhegyllysgrtilksih
lsdetnlnspiqpyenpdffknvislafdynsnekgpnrifysdahfgniqlinddwtgr
kviienvgsveglayhrawdtlywtssttssitrhtvdqsrrgafnreavitmseddhph
vlaldecqnlmfwtnwneqhpsimrstlsgqnaqvivstdivtpngltidhpaeklyysd
gslgkierceydgshrhvivrsgpgtffslaihndyifwsdwvrrailrsnkytggetkv
lrsdiphqpmgiiavtndtntcklspcsymnggchdlclitpdgrincscrgdrvlvndn
rcvsknsscnmfsefecangecieyhqtcdgivhckdrsdekqsycenrscwrgfrlcgn
hrcipnnkvcndeddcgdnsdeldckistcastefrctdgtcitksaqcnqiidcadasd
ekncnntdcthyyklgvktagfircnstslcilpewicdgandcgdysdelkcpaqnkqk
ceenyfecqngrcisnawvcdgqrdcedgrdelhcdtscswsqfacsknkciskqwvcdg
eddcgngldeseelcgsvtcaagffscpgshacvpshwlcdgerdcpngsdelstadcap
vttcdenafmcnnkvcipkqfmcdldddcgdgsdeslecgyhqcgpeefscadgrcllns
hwqcdgdfdcadhsdeaplnkkcrnteqscnsssfmckngkcvpkgalcdtrddcgdgsd
ergchvneclskrvsgcsqdcqdlpvgykckcwpgfrlkndgktcvdideclsgfpcsqq
cintygtykclcadgyqihpeypngckslseedpfllladhheirkmstdglnytmlkqg
lnnviamdfdyreeviywidssrsngsrvnrmfvngsdvkhtyrylywidcceyphvgrv
gmdgtnqsvvietmisrpmaltidyvnkriywanenhiefsdmngsnrhkvpyqdvqgvi
altlfedyiywtdgktkslnrahktsgenkaslinswhaisdieiyhayrqpdvpdhpck
mnngdcshlcllspqkshtcacptnfylaedkktclsnctasqvcqssrvmsd
Download sequence
Identical sequences gi|301615896|gb|XP_002937402|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]