SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301615910|gb|XP_002937413| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301615910|gb|XP_002937413|
Domain Number 1 Region: 680-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000474
Family Laminin-type module 0.00031
Further Details:      
 
Domain Number 2 Region: 284-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000352
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 3 Region: 798-879
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000366
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 4 Region: 639-682
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000711
Family Laminin-type module 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|301615910|gb|XP_002937413|
Domain Number - Region: 246-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000268
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 541-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family EGF-type module 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301615910|gb|XP_002937413|
Sequence length 1288
Comment PREDICTED: laminin subunit gamma-2-like [Xenopus (Silurana) tropicalis]
Sequence
mdrrvemdlrkaflvsckpavalvsvakamamwidgidralleganvkdisaspgelkla
anfmsegavdctrtpkrlpispaglesgcdrrllyrlgcpsgfrmglgevgsavkvlidi
ssvsvqpilseveenifpltaaylpgcgkpegrlleqtcpvdprvvpqlgdisgekcgve
rnmlhvtyvrrfyppvsvrvhkkewiafclalpcggtqdnstsgelrakhpsvpalecvf
dpdllaqtgsgfrcincnggtdgphcehciegyypqpdgtcgpclchtvgslnqqcdnng
qcrckpgvmgskcdqcqpgfhslsdtgcrckpgyyhldgsrpegclqcfchghsatcsss
slhsvhkiissfqkdtegwssvqrdgstapvplrmsrhqkevyiasrqqeplyfnapaqf
lgdqslsygqalsisfrvdrgryragtedlvlegnglrvtatltssknslpcripqtytf
rldelsrspwtphlshfdfrrllrnvtsihiratygeystgylqnvtlisarpvqgepap
wveqcvcpsgyqgqfcercargyrrespglgalsscvscncpggghcdpdtgdcysgden
qnndcadcpqgqyndprdpmsclpcpcsagigcslspetqepvcdecpvglngprceica
egyfgdpqgergaprpcrpcqcnnnidrsvegscdrvtgeclkcihntagyycdrckdgf
fgnplatapelkckacychpvgtvhqgcqkdgscqcktgfegrscdqpqcpdcysqvstk
lnlykrqllkltgenngqspargeleermrkaeaaaqglqrdseaangaalslqrqfsgl
qgtqsdtqnvldqakeklqglqtqknqyqgqlqdmgrkinialqqlqgsqeelnrmtfps
tnlpldsgsysklrqeaqeianrlaqeaqtvaqdaaeaqgdteralqilrtggadpetad
klkarmeeartqarsleteaiqaaaaaerahhdsmqtarafgqlppitsvafqladqlls
ranaaktkatqamntgnatfyeidgilmslkgfgdqvgdrrseaedamrrlpeirlrvqd
atdstkrtetalkgaasdasraegnareanniaseiqlnmlqmsqdannsaemalalerd
laeirrlaidtgasldgknqaaerdsavadevarkaleaeasalgvhdavtatlstldrm
lhildqplnineeglkaleasmgaartqlngrlkpavqdlelaaqlqkqnmitvekeisq
tlidiqnlrdirdnlppgcysttaiekp
Download sequence
Identical sequences gi|301615910|gb|XP_002937413|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]