SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301616394|gb|XP_002937635| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301616394|gb|XP_002937635|
Domain Number 1 Region: 1204-1398
Classification Level Classification E-value
Superfamily Fibronectin type III 3e-38
Family Fibronectin type III 0.0000019
Further Details:      
 
Domain Number 2 Region: 592-794
Classification Level Classification E-value
Superfamily Fibronectin type III 1.43e-37
Family Fibronectin type III 0.0000105
Further Details:      
 
Domain Number 3 Region: 995-1202
Classification Level Classification E-value
Superfamily Fibronectin type III 1.96e-34
Family Fibronectin type III 0.0000165
Further Details:      
 
Domain Number 4 Region: 794-986
Classification Level Classification E-value
Superfamily Fibronectin type III 1.27e-33
Family Fibronectin type III 0.00000551
Further Details:      
 
Domain Number 5 Region: 1726-1920
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-31
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 6 Region: 1582-1727
Classification Level Classification E-value
Superfamily Fibronectin type III 2.55e-28
Family Fibronectin type III 0.00063
Further Details:      
 
Domain Number 7 Region: 1401-1547
Classification Level Classification E-value
Superfamily Fibronectin type III 1.31e-27
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 8 Region: 27-94,138-206
Classification Level Classification E-value
Superfamily Immunoglobulin 5.39e-21
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 9 Region: 407-505
Classification Level Classification E-value
Superfamily Immunoglobulin 4.11e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 10 Region: 302-401
Classification Level Classification E-value
Superfamily Immunoglobulin 3.85e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 11 Region: 500-599
Classification Level Classification E-value
Superfamily Immunoglobulin 7.97e-18
Family I set domains 0.028
Further Details:      
 
Domain Number 12 Region: 217-316
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000172
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301616394|gb|XP_002937635|
Sequence length 2174
Comment PREDICTED: protein sidekick-2-like [Xenopus (Silurana) tropicalis]
Sequence
mpgtwgklwiclaalqilcpcwaqddvppyfktepvrsqvhlegnrlvltcmaegswple
fkwlrdhkeltkfsleyrymitsldrthagyyccivrnrmgallqrktevqvaymgnfed
gdtslsvshgdaavinapniasfpqpqvtwfrdgrkipptnriaitknntlvilssvapd
tgryyvqavndkngdnktsqpitltvenvggpadpiapiiiippqntsvvtgtsevsmec
vanarpltklnivwkkngvplsngvtefgrfltilnpvlsdagyysceatlrsssvppvs
agayltvleppqfvkepdrhltaemekvveipcqakgvpqpiiswykdavlidirrdarf
rlvssgslrisglipddtgmfqcfarneagevqtstylavtsiapnitrapqdttvidgt
avvlqcetsgaprpaitwqkgdrvlasgsiqlprftllesgsllispahisdtgtytcsa
tnsrgaddasadiivwartritnppsdqsvikgtkasmscgvshdssvairyvwekdgfp
vsvenspriqldkngtlhisqtwsgdigtytcrvlsvggndsrsahlrvrqlphapenpv
atlslvesrainltwvkpfdgnspllryivevsennapwtillgsldpeqtalvvrnlvp
arsyqfrlcaandvgkgqfskdtqrvslpeeppsappqnvmasgrtnqsimiqwqpapen
hqngilkgyvvryclsglpvgyqyrnlsnpsinhllledliiwtnyeievaafnsagvgv
fsgkvtewtlqgvptvppenvkteavnstairftwnppspqfvnginqgyklmvwepgqe
deimvitvrpkfqenthvgiisglkkftsyitsilcfttpgdgprsqpqlvwtqedvpgp
vghlsfddildtslrvtwqepaeknglltgykisweefnqtntrvthylpnvtleyrvtg
ltslttytiqvagmtskgqgvvssstissgvppelpgapsnlgisnigsrsvtlqfrpgf
dgktsiskwlveaqvgnptesddwvliyqlanepnarslgvsglrpynyysfrmrqvniv
gtsppslpsrriqtlqappsmfpanetlrtasqtslwvrwvplpemeyngnpdsvgykir
yarldkkgkpfthviydriereytiedleewteyavqiqafnaigagpwspvitartres
vpssgptnvsalattsssilvrwseipepernglilgykvlykekdsdtsthfwlvegns
srsaqlsglgkyvlyeiqvlaftrigdgaastpailertlddvpgppvgilfpevrttsv
rliwqppaapngiilayqithrlnatnantatvevlnpsvrqytatalrpesiylfrita
qtrkgwgeaaealvvttekrdrpqppskptvlqedvkartvllswdpgsdglspvryyti
qtlelpkgkwvvhsatishnstsavvdrlkpftsykfrvkatndigdseyseesealttl
qaapgeaptilsvnphtttsvlirwqapaedringillgfcirfrelaydglrsftmqsi
nnpgakwaeltasymmrnlseptltqyeldnlnkhkryeirvsmynaagegpssipqevf
vgeavptappqniaiasttavqldvtwepppleaqngdiqgykifyweilrknetekvrt
lflpetgvklknltgyttylisvaafnaagdgprgqpirgqtqqaapsapasirfseltt
tsvnvswdapiypngilegyrlvyepctpvdgiskivtvdvkgnsplwmkvkdlaegvty
rfriraktftygpdieanvttgpgegapgppgepfisryssaitihwssgdpgkspitry
iiearpsdeglwdilikdipkeatsytfsidilkqgvsydfrviavndygygtpsapsps
vsaqkanpfyeewwflvvialiglifilllvfaliirgqskkyakksdsacnpktnslgh
gemvsldesrfpalelnnrrlsvknsfcrkngiytrspprpspgslhysdedvtkyndli
ptesgsltekpsevsdsqgsdseyevdqnqqkthsfvnhyisdptyynswrrqqkgisra
haynysenepedsdhciipnsnsshqgslyrpkasrtptpqqshslpsqnpiyrppssla
paarapiagfssfv
Download sequence
Identical sequences gi|301616394|gb|XP_002937635|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]