SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301616718|gb|XP_002937799| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301616718|gb|XP_002937799|
Domain Number 1 Region: 224-315
Classification Level Classification E-value
Superfamily Immunoglobulin 8.16e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 125-228
Classification Level Classification E-value
Superfamily Immunoglobulin 1.84e-16
Family C1 set domains (antibody constant domain-like) 0.046
Further Details:      
 
Domain Number 3 Region: 31-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000317
Family V set domains (antibody variable domain-like) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301616718|gb|XP_002937799|
Sequence length 394
Comment PREDICTED: cell adhesion molecule 3-like isoform 2 [Xenopus (Silurana) tropicalis]
Sequence
mhrpvilllclssltgaanlppedpsqpvtadvvvptggtailkctvqehqesslqwsnt
aqqtlyfgekralrdnriqlvhsspneltisisnvvlsdegeytcsiftmpvrtakavvt
vlgvpqkpqvfgfdlpfkendkarlrcttsgskpaaiikwykgpeelegaktsvledgng
ktftvmsfieftvtkdddgaeitcavgheslhdsskssshkiqvqykptakiesrpnmpr
egdklrlqcdaygnpvpenyvwerengelpvlaniegnslvfltlnksdsgtytctasna
lgtfithykldvndpspipstssidhaviggvvaviafllfcllivlgrylirhkgtylt
heakgsddapdadtaiinaeggqggaddkkeyfi
Download sequence
Identical sequences XP_002937799.1.99540 gi|301616718|gb|XP_002937799|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]