SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301617936|gb|XP_002938378| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301617936|gb|XP_002938378|
Domain Number 1 Region: 268-342
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.58e-16
Family Complement control module/SCR domain 0.0063
Further Details:      
 
Domain Number 2 Region: 519-582
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.48e-16
Family Complement control module/SCR domain 0.0074
Further Details:      
 
Domain Number 3 Region: 395-461
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000262
Family Complement control module/SCR domain 0.0063
Further Details:      
 
Domain Number 4 Region: 462-522
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000603
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 210-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000998
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 86-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000378
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 337-396
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000005
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 8 Region: 143-205
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000125
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 9 Region: 28-94
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000301
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301617936|gb|XP_002938378|
Sequence length 584
Comment PREDICTED: coagulation factor XIII B chain [Xenopus (Silurana) tropicalis]
Sequence
msawgslyvfasilccivvraqqaaqlcdqpelqngefrywysfpsstlraieyscyehy
vplnktnendtygvarctengwdprpkclgkpcrwapavenaniielkanytdgesvkfv
cnagyemaehseaqcrngqwiniptcvsllcgpapivgnarlvsgkatyrstekatyecd
sgfvfhtnkealckkgqwveipecrkqgqscgpppvvqfgdivsprmashlhgsvthyvc
vnyyvlegnprmtcrngkwddppvciepcvlgekymsssnialrwtaakrlflrhgdfvg
frcldgyeisdgallrvpcirgtvtypsctkqgqgescgkppavrygdtlepqmkshthg
svmtykcpefyilegkdkvacrngkweeppvciepctvygeelkenhvsmkwiardklym
rhgefvefectygyeipdmaqlrvqcnsgvllypkchkyegcgyppnvpngdaieerssf
yahgasieyrcpeyytlegpsritcrdgiwddppvciepctvsdkdlkannlrlkwisrq
klylrhqdfvgfvcvygyeipdekqlrvqcrngvlplptchrsg
Download sequence
Identical sequences gi|301617936|gb|XP_002938378| XP_002938378.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]