SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301617938|gb|XP_002938379| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301617938|gb|XP_002938379|
Domain Number 1 Region: 336-401
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000878
Family Complement control module/SCR domain 0.0076
Further Details:      
 
Domain Number 2 Region: 154-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000958
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 3 Region: 86-153
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000249
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 4 Region: 277-333
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000264
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 211-277
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000089
Family Complement control module/SCR domain 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|301617938|gb|XP_002938379|
Domain Number - Region: 26-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000104
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301617938|gb|XP_002938379|
Sequence length 421
Comment PREDICTED: complement factor H-related protein 5-like [Xenopus (Silurana) tropicalis]
Sequence
mgpvgvlvcvlccivvgaqpserkgcgrpviqngrveslyvvgrlksirylcnggyiadk
kgpkseygtakctengydpkprclapcslseedmdangiamalhrvwltspikhgdtasf
rckegyeisdsklldstcsdgvltypnctkpdgcgpppevshgetvedpnkfyehgaavt
ykcqqsytlegkkqiscrngqwddppvckgpcslseeemeanglrldyplwwrsspvkhe
nivsfscvqrydisdssllrvrcndgvvmypkcmklescgpppevplgetvqgqlesygh
gsvmtyrcpqyytlegkqnvtcrngtwdeppacrepckvtckdldeknitwiwpfpikrh
vlhgefilfhclegyetskkdllmvqcqqgrmaipncteqdphaegtphrsdfwqmfkpp
m
Download sequence
Identical sequences XP_002938379.1.99540 gi|301617938|gb|XP_002938379|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]