SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301617940|gb|XP_002938381| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301617940|gb|XP_002938381|
Domain Number 1 Region: 337-403
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000603
Family Complement control module/SCR domain 0.0061
Further Details:      
 
Domain Number 2 Region: 156-216
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000958
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 3 Region: 213-280
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000021
Family Complement control module/SCR domain 0.0061
Further Details:      
 
Domain Number 4 Region: 279-334
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000403
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 88-155
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000485
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 6 Region: 25-86
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000742
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301617940|gb|XP_002938381|
Sequence length 422
Comment PREDICTED: complement factor H-like [Xenopus (Silurana) tropicalis]
Sequence
mgpvgvlvsvlccivvgaqaseektcgkpviqngrvdtwfwvdrpidgnanyrcnegyip
vnkerrseygtakctengwdpkprclapcslseedmdangiamsrflrwltspikhgdna
ifsckkgyeisdskmlyskcsdgvltypkctkpdgcgpppevshgetvedpnkfyehgaa
vtykcqqsytlegkkqiscrngqwddppvckgpcslseeemeanglriddplwrsspvkh
knivsfscvqtydisdssllrvrcndgvvmypkcikqescgpppevplgetvqgqlesyg
hgsvmtyrclqyytlegkqnvtcrngtwdeppacrepckvtckemeenkinwirlfpfkr
hvphgdfmlfycvegydisnktllmvqcqqgrmaipkcteqdphaegtpqwsdfwqmfkp
pk
Download sequence
Identical sequences XP_002938381.1.99540 gi|301617940|gb|XP_002938381|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]