SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301617942|gb|XP_002938382| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301617942|gb|XP_002938382|
Domain Number 1 Region: 211-273
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8e-16
Family Complement control module/SCR domain 0.0078
Further Details:      
 
Domain Number 2 Region: 153-209
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 86-150
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000499
Family Complement control module/SCR domain 0.0067
Further Details:      
 
Domain Number 4 Region: 24-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000391
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301617942|gb|XP_002938382|
Sequence length 276
Comment PREDICTED: coagulation factor XIII B chain-like [Xenopus (Silurana) tropicalis]
Sequence
mepigvlvcvlccivvgaqpsdnkcenpklehgrlfpwlfsdlsintairyrcdegyvaa
nqvsksygsakctntgwdpepkclgpcstskedmnangirtgfvflwtrspiehgdsilf
rcvpgygisdpsllrvqcndgvipypkctklegcgpppivlhgetvqdrvksyehgsvmt
ykcplsytlegnqnitcrngkwddlpackepcvvnskdveennirllwlgtekqyvqhgd
yirfrclrgygipdynmltvkchqgivaypkctaqe
Download sequence
Identical sequences gi|301617942|gb|XP_002938382|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]