SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301617987|gb|XP_002938412| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301617987|gb|XP_002938412|
Domain Number 1 Region: 103-444
Classification Level Classification E-value
Superfamily L domain-like 4.93e-62
Family Internalin LRR domain 0.042
Further Details:      
 
Domain Number 2 Region: 586-681
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 673-767
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 481-591
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 5 Region: 31-119
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000102
Family Ngr ectodomain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301617987|gb|XP_002938412|
Sequence length 1043
Comment PREDICTED: leucine-rich repeats and immunoglobulin-like domains protein 1-like [Xenopus (Silurana) tropicalis]
Sequence
mqpitgrstfllgilfhlgmglpqqplcppsctctgdlldcsnlgltappsdlpawtvhl
nlssnklkeidpaafaqlpelrevhlghneltgiphlgtaapqvttlslhhnkirsidps
qlkpyvaletldlssnelteirsgsfpaglrikelhlgsnkisslepgsfdslsrslltl
rlsknrisqlpvkvfrlprltqlelnrnrirliegltfqgleslevlklqrnniskltdg
afwglsrmqilhlennsltevnsgslygllslqqlhlshnsistissagwsfcqklqelv
lshnnltrldegsladlgvldvlrlsynsishiaegafkglkslrileldhneisgtied
tngafigleslnkltlfgnkiksvakrafsgieslehlnlgenalrsvhseafgemknlk
elvvgsssflcdchlkwlpqwltsrrlqtkvkascahpgslnntsifsvpprsfvcddlp
kpqirvqpettmavlgkairftcsaassspspmtfawkkdneilhnaevenfasgtereg
evteyttilhlrnltfahegryqciitndfgpsysskarltvnvlpsfiktprdstirag
trarlecaadghptpeiawqkdggtdfpaarerrmhvmpdddvffimdvkiedmgvysct
aqnsagsvsanatltvlempflvhpledrvvstgatlalqckasgspppritwlkgdepl
vmterhhytpgnqlliirqvmsedagkytcemsntlgterayshvsiastagcqgekdkm
egmmtfgiitiavvcsivltslvwvciiyqtrkksevysvtntdetivppdvpsylssqg
lcssdgsvnpeaeacsvayrqprlctcssgeacktadglfgpestgfgfqvvctdcldgg
agyssksdycpqtvqsvdcsyqkpagshdrymcngdtptalsyhhnaamdegsnlesggn
mypsnherigtakalnsnlldpcaeplirspesegfraapssdcypypdpssedsakqtl
lpnghaptlsgqhraqtgssapk
Download sequence
Identical sequences XP_002938412.1.99540 gi|301617987|gb|XP_002938412|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]